(data stored in ACNUC1104 zone)

EMBL: CP000717.PE252

CP000717.PE252       Location/Qualifiers
FT   CDS_pept        complement(301151..301972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10252"
FT                   /old_locus_tag="TBFG_00249"
FT                   /product="hypothetical succinate dehydrogenase membrane
FT                   anchor subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0249c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04595"
FT                   /protein_id="ABR04595.1"
FT                   /translation="MSAPTANRPAIGVFTPTRAQIPERTLRTDLWWLPPLLTNLGLLAF
FT                   ICYATTRAFWGSQYWVEKYHYLTPFYSPCVSASCQPGASHLGVWFGHFPGWIPLGAMVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTSCAVPEPRAHYTGETRLPLIVQNTHRYFFYIAV
FT                   VVSLINTYDAIAAFHSPSGFGFGLGNVILTINVVLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMQFAWITLGTLALTDFYIMLVASGSITDLRFIG"
     atgagcgcac ccacggcgaa ccgtcctgcg atcggcgttt tcacacccac ccgcgcacaa        60
     atcccagaac ggacgcttcg caccgacctc tggtggttgc caccgctgct gaccaacctc       120
     ggtcttttgg cgttcatctg ctatgcgacc actcgggcgt tctggggcag ccaatactgg       180
     gtggaaaaat atcattacct gacgccgttc tactcgccgt gcgtcagcgc gtcctgccag       240
     cccggcgcca gtcatctcgg cgtctggttc gggcattttc cagggtggat tccgttggga       300
     gcgatggtat taccgttcct gcttggattc cggctcacct gctattatta ccgcaaggcc       360
     tactaccggt cggtatggca gtcgccgaca agctgcgcag tgcccgagcc gcgggctcat       420
     tacaccggtg aaacccggct tccgctgatc gtccagaaca cccaccggta tttcttctat       480
     atcgcggtgg tggtgtcgct gatcaacacc tatgacgcga tcgcggcatt tcactcgccg       540
     tccggattcg gcttcggttt gggcaatgtc attttgacga tcaatgtggt tctgctgtgg       600
     gcatacacca tctcgtgcca ttcgtgccgg cacgccaccg gcggtcggct caagcatttc       660
     tccaagcacc cagtgcgata ctggatctgg acacaggtca gcaagctcaa tacccgacac       720
     atgcaattcg cgtggatcac gctggggacc ctggcgctca ccgatttcta catcatgctg       780
     gtggccagtg gcagcatcac agatctcaga tttattggct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page