(data stored in ACNUC1104 zone)

EMBL: CP000717.PE253

CP000717.PE253       Location/Qualifiers
FT   CDS_pept        complement(302052..302345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10253"
FT                   /old_locus_tag="TBFG_00250"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0250c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04596"
FT                   /protein_id="ABR04596.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
     ttgtccacga ctgccgaact cgccgaactg cacgacctcg tcggcggact gcggcggtgc        60
     gtgaccgcac tgaaggcgcg attcggcgac aacccggcaa cgcgtcgcat cgtgatcgat       120
     gccgaccgga tcctcaccga catcgaattg ctcgacaccg acgtctctga attagacctg       180
     gaacgggccg ccgtaccgca acccagcgag aaaatcgcca tccccgacac cgagtacgat       240
     cgcgaatttt ggcgcgatgt cgacgatgag ggtgtcggag gtcacaggta ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page