(data stored in ACNUC1104 zone)

EMBL: CP000717.PE254

CP000717.PE254       Location/Qualifiers
FT   CDS_pept        complement(302490..302969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10254"
FT                   /old_locus_tag="TBFG_00251"
FT                   /product="heat shock protein hsp (heat-stress-induced
FT                   ribosome-binding protein A)"
FT                   /note="Mapped to H37Rv Rv0251c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04597"
FT                   /protein_id="ABR04597.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
     atgaacaatc tcgcattgtg gtcgcgtccg gtgtgggacg ttgagccctg ggaccgctgg        60
     ctacgtgact tcttcggccc tgccgcgacg acggactggt accgcccggt cgccggagac       120
     ttcacgccgg ccgccgagat cgtcaaggat ggcgacgacg cggtggtccg tttggaactg       180
     cccggcattg acgtcgacaa ggacgtcaac gtcgagcttg accctggcca gccggtgagc       240
     cgcctggtga tccgcggcga acaccgcgac gagcacacgc aagacgccgg agacaaagac       300
     ggccgcaccc tgcgtgagat ccgctacgga tcattccgcc gctcgttccg gctgcccgcg       360
     cacgtcacca gcgaggccat cgcggcttcc tatgacgccg gtgtgctgac cgtccgggtt       420
     gccggcgcct acaaggcccc agccgaaact caggcgcagc gcatcgccat cacgaagtag       480
//

If you have problems or comments...

PBIL Back to PBIL home page