(data stored in ACNUC1104 zone)

EMBL: CP000717.PE256

CP000717.PE256       Location/Qualifiers
FT   CDS_pept        305770..306126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10256"
FT                   /old_locus_tag="TBFG_00253"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /note="Mapped to H37Rv Rv0253"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04599"
FT                   /protein_id="ABR04599.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
     gtgacgcttc tcaacgacat tcaggtatgg accaccgcct gcgcatacga ccatctcatt        60
     ccgggacgtg gtgtcggggt gttactcgat gacggtagtc aggtggcact gttccggctc       120
     gacgacggct cggtgcacgc ggtcggtaac gtcgacccgt tctccggtgc tgcggtgatg       180
     tcccgcggca tcgtcggtga tcgcggaggt cgcgccatgg tgcaatcgcc gatcctgaag       240
     caggctttcg cgctcgacga tggctcgtgc ctcgacgatc cgcgcgtttc ggtgccggtg       300
     tatccggcgc gcgtcacacc cgaaggccgc attcaggtcg cgcgggtagc ggtctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page