(data stored in ACNUC1104 zone)

EMBL: CP000717.PE260

CP000717.PE260       Location/Qualifiers
FT   CDS_pept        310016..310390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10260"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0257"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04603"
FT                   /protein_id="ABR04603.1"
FT                   /translation="MTRVSWLPDRCLPRLPACGRGLRGSLPGDSGGTAPDSHRLPASSS
FT                   PDGKNIGMQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAWPAVLFPS
FT                   WSWLCGIGGGVDLQKPSCRA"
     atgacgcgag tctcctggct cccggatcgt tgcttgcctc gccttccagc ctgtggccgt        60
     ggcttacgag ggtcgctccc cggtgacagt ggcgggaccg cgccggattc tcaccggctt       120
     cctgcatcgt catcgcctga cgggaagaat attggcatgc agagcgtgga tttgcacgtt       180
     gagcggcatt tgccaagcag gggtcggtca catcgcacgg tcgcaacagt cacatgtgtc       240
     actgcactag gcgacatccg atctgcccag ctctcagcga caggcgcctg gccggcggtt       300
     ttgttcccaa gttggtcgtg gctgtgcggg attggaggcg gcgttgacct gcagaaaccg       360
     agttgtcgcg cttag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page