(data stored in ACNUC1104 zone)

EMBL: CP000717.PE264

CP000717.PE264       Location/Qualifiers
FT   CDS_pept        complement(311831..312976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10264"
FT                   /old_locus_tag="TBFG_00260"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0260c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04607"
FT                   /protein_id="ABR04607.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
     atggcccagg cacactcggc gccactgacc ggctaccgga tcgcggtgac atccgctcgc        60
     cgcgccgaag agctgtgcgc attgcttcgc cgccagggcg ccgaggtctg tagtgcccca       120
     gcgatcaaga tgatcgcgct tcccgacgac gatgaactgc agaacaacac cgaggcgttg       180
     atcgccgacc cgcctgacat tctggtcgcc cacaccggca tcggatttcg cggctggttg       240
     gccgcggccg aggggtgggg gctggccaac gagctcctgg aatcgttgtc gtcggcccgg       300
     atcatctccc gcggaccaaa ggcaactggt gcgctgcgtg ccgccggcct gcgtgaagag       360
     tggtcccccg actctgaatc gtcgcatgaa gtgctggaat atctgctcga atcgggggtg       420
     tcccgtacgc gtattgccgt ccagctgcac ggtgccgccg acagctggga cccgtttccg       480
     gaatttctgg gcgggttacg tttcgccggc gcgcaagtgg tgccgatccg ggtttaccgg       540
     tggaagccgg cgccactagg cggcgtgttc gaccatttag tcaccgggat cgcgcgacga       600
     caattcgacg cggtcacctt cacgtcggca cctgccgcag ccgcggtgct agaacgcagc       660
     cgtgaattgg atatcgagga ccaactgttg gctgcgctgc gtaccgacgt gcacgcgatg       720
     tgtgtcggcc cggtaacttc gcggccgttg atccgaaagg gcgtcccgac gtcggctccc       780
     gagcgaatgc ggttgggagc cttagcccgc cacattgccg aggagctgcc gctgctgggt       840
     tcgtgcacgt tcaaagcagc cggccacgtg atcgagatcc gtggaacctc tgtgctggtg       900
     gatgattcgg tgaagccact atcgccgtcc ggaatggcga ttttgcgcgc gttggtacat       960
     cgccccggcg gcgtcgtctc tcgtggcgac ttgctacgcg tcctacccgg cgacggcagc      1020
     gacacccacg ccgtggacac cgccgtactg cggctacgaa cggctctggg cgacaagaac      1080
     atcgtggcaa cagtggtgaa acgtggctac cgtctcgccg ttgacagccg gcacgatgac      1140
     gtatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page