(data stored in ACNUC1104 zone)

EMBL: CP000717.PE276

CP000717.PE276       Location/Qualifiers
FT   CDS_pept        complement(328892..330025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10276"
FT                   /old_locus_tag="TBFG_00272"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0272c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04619"
FT                   /protein_id="ABR04619.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
     ttgactggtc gtgctgccac gcccggggtc atccgagagt tcgtcgggct gccgtcgcga        60
     accgcggggc gtgcggctgc cggtgggcac ccatgccagg ggctgtacca ccacagcgtg       120
     ggacgcaaac cgaaggtggc gctcatcgcc gcgcactacc agatcgattt ctccgagcac       180
     tatctcgccg agtacatggc gatccgcggc atcgggtttc tgggctggaa cacccgattc       240
     cgtggtttcg aaagcagctt tctgctcgat cacgcactgg tcgacatcgg cgtcggggtg       300
     cgctggctcc gcgaagttca gggcgtggaa acagtggtgt tgcttggcaa ttcaggtggt       360
     ggctcattga tggccgccta ccaatcacaa gcggtcgatc cgaacgtgac tcccctggac       420
     ggtatgcgac ccgcagccgg ggtaaccgaa ttgccggccg ccgacgcata cgttgccgcc       480
     gcagctcatc ccggccgtcc ggatgtgctc accgcttgga tggacgccgc cgtcattgac       540
     gaaaatgatc cggttgcaac cgatcccgaa cttgacctgt tcgacgaacg caacgggccg       600
     ccgtactcac cggagtttat cagccggtat cgctccgcgc aggtcaaacg caaccacacc       660
     atcaccgact gggccgaatc cgaactcaaa cgtgttcgcg cagctggctt ttctgatcgg       720
     ccgttcagcg tgatgcgtac ctgggccgac ccgcgcatgg tcgatcccag catcgaaccg       780
     accaagcgtc ggcccaacca gtgctacgcg ggcacgccgg tgaaggcgaa ccgctccgca       840
     cacggcatcg ccgcggcctg cacgctgcgc ggctggctgg gcatgtggag cctgcgggtg       900
     gcccaaaccc gtgccgcacc ccacctggcc cggatcacct gcccggccct ggtgctcaac       960
     gccgaggccg acaccggaat cttcccgtcg gatgcccagc agatctacga cgggctcgcc      1020
     agcagcgaca agactcaggt ctcgatcgac accgaccatt acttcaccac cccgggcgcc      1080
     cgcagcgagc aggccgacac catcgccaag tggatagcca agcggtggcg ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page