(data stored in ACNUC1104 zone)

EMBL: CP000717.PE277

CP000717.PE277       Location/Qualifiers
FT   CDS_pept        complement(330022..330642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10277"
FT                   /old_locus_tag="TBFG_00273"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0273c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04620"
FT                   /protein_id="ABR04620.1"
FT                   /translation="MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLA
FT                   EAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMF
FT                   NQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN"
     gtgccggact tcccgacgca acgcggtcgg cggacccagg ccgcaatcga cgccgccgcg        60
     cggacggtcg tggtgcgcaa cggaatcctg gcgaccaccg tcgccgacat caccgccgaa       120
     gccggccgct cggcggcatc cttttacaac tactacgact ccaaagaggc gatggtccgg       180
     cagtgggcgc tgcgcttccg cgacgacgcc aaccagcggg cattgtcggt gatccggcac       240
     ggcctatccg accgcgagcg cgcgtatgaa gccgctgccg cccattggta cacctaccgc       300
     aaccgcctcg cagaagcgat cagcgtgtca cagttggcga tggtcagtga cgacttcgcg       360
     caatactggt ccgaaatatg ccagattcca atatcgttca tcaccgagac ggtcaaacgc       420
     gctcaggcgc acggctattg cgtcggcgat gacccccagt tgatggccga ggcgattgtg       480
     gcaatgttca accagttttg ctacctgcag ctcagcggta agcgttcacg ccgtggacaa       540
     cctgacgatc aggcgtgcat ccagaccttg gccaacattt actaccgcgc catctacagt       600
     aaggaggaca gctcaaattg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page