(data stored in ACNUC1104 zone)

EMBL: CP000717.PE278

CP000717.PE278       Location/Qualifiers
FT   CDS_pept        330697..331320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10278"
FT                   /old_locus_tag="TBFG_00274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0274"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04621"
FT                   /protein_id="ABR04621.1"
FT                   /translation="MARPPSRGANGSRTMIKPHNTNTEFELGGINHVALVCSDMARTVD
FT                   FYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIG
FT                   DITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVR
FT                   SFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR"
     ttggccaggc cgccgtcccg gggagccaat gggagccgca cgatgatcaa gccgcacaac        60
     accaacaccg aattcgagct tggtgggatc aaccacgtcg cgctggtgtg ttcggacatg       120
     gcgcgcaccg tggacttcta cagcaacatc ctggggatgc cgctgatcaa ggcgctcgat       180
     ctgcccggcg gccaagggca gcacttcttc tttgacgccg gcaacggcga ttgtgtcgcc       240
     ttcttctggt tcgccgatgc acctgatcgg gtgcccggtc tttcgtcgcc ggttgccatc       300
     cccggcatcg gcgacatcac cagcgcggtg agcaccatga accatctggc gtttcatgta       360
     cccgccgaaa ggttcgacgc ctaccggcag cggctcaagg acaaaggcgt gcgggtcggc       420
     ccggtgctca accatgacga cagcgagacg caggtgtccg cggtggtgca tcccggtgtg       480
     tacgtacgct cgttctactt ccaggacccc gatgggataa ctctggaatt cgcttgctgg       540
     acaaaggaat tcactacgag cgacgcgcag gccgtgccga agacggcggc tgaccggcga       600
     cctccggtgg ctgcggatcg ttag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page