(data stored in ACNUC1104 zone)

EMBL: CP000717.PE279

CP000717.PE279       Location/Qualifiers
FT   CDS_pept        complement(331250..331975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10279"
FT                   /old_locus_tag="TBFG_00275"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0275c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04622"
FT                   /protein_id="ABR04622.1"
FT                   /translation="MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIR
FT                   TICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANI
FT                   VRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVA
FT                   HFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDP
FT                   QPPEVAGQPPSSARPARRS"
     atgacgcgca gtgatcgacc ctaccgcggc gtcgaggccg ccgagcgact ggcgacgcgc        60
     cgtcgccagt cgctctctgc cggcctggac ctgttggggt ccgaccagca cgacatcgcc       120
     gagctaacca tccgcaccat ttgccggcgg gccggcctgt cggtgcgcta cttctacgaa       180
     agcttcaccg acaaggacga attcgtcggc cgcgtgttcg actgggtggt ggccgagctg       240
     gtcgccacca ctcaggccgc ggtcacggcg gtaccggcgc gggagcagac tcgcgcgggc       300
     atggccaaca tcgtgcggac catcaccgca gacgcccgcg tcggacgcct gctgttcagc       360
     acacagctgg ccaacgcagt gatcacccgc aagcgtgcgg aatccagcgc cctgttcgcc       420
     atgctgtccg gccaacatgc cgtcgacacc ctgcacgcac cggcaaatga ccacgtcaag       480
     gcggtcgcac acttcgccgt cggcggcgtc gggcagacca tcagcgcctg gctggccggt       540
     gacgtgcgac tcgatcccga ccagctggtc gatcagctag ctgcgctgct cgatgaactc       600
     accgacccaa acttgtcccg tccccgggta gcggcaacag ctgccaaatc cggggctaac       660
     gatccgcagc caccggaggt cgccggtcag ccgccgtctt cggcacggcc tgcgcgtcgc       720
     tcgtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page