(data stored in ACNUC1104 zone)

EMBL: CP000717.PE28

CP000717.PE28        Location/Qualifiers
FT   CDS_pept        31615..31920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10028"
FT                   /old_locus_tag="TBFG_00028"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0028"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04371"
FT                   /protein_id="ABR04371.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
     atgaccgacg ccaatcccgc tttcgacacg gtccacccca gcgggcacat tcttgttcgg        60
     tcctgccgcg gtggatacat gcatagcgtc tcgctgagcg aggcggcgat ggagaccgac       120
     gcagaaaccc tggcggaagc catcctgctc accgccgacg tgtcctgcct taaagcgttg       180
     ctggaagtac gcaacgagat cgtggcggcg ggccacaccc cgtccgcgca ggttcccacg       240
     accgacgacc tgaacgtcgc gatcgaaaag ctgctggccc atcaactgcg ccgccgtaac       300
     cgttga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page