(data stored in ACNUC1104 zone)

EMBL: CP000717.PE281

CP000717.PE281       Location/Qualifiers
FT   CDS_pept        complement(333025..333453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10281"
FT                   /old_locus_tag="TBFG_00277"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0277c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04624"
FT                   /protein_id="ABR04624.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
     atgttcctca tcgacgtcaa cgtgctgctg gctgcacacc gcggtgacca tccgaatcac        60
     cgaaccgtcc gcccctggtt cgatcgactg cttgcggccg acgacccctt cacagtgccg       120
     aacctagtgt gggcgtcgtt cctccggcta acaacgaatc gacgcatctt cgagattccg       180
     tcaccacgag cggatgcatt cgcattcgtc gaagccgtca acgcccagcc ccatcacctt       240
     ccgacaagcc ccggccccag acacctggtg ctgctgcgaa aactctgcga cgaggccgac       300
     gcatcgggcg acttgatacc tgacgcggta ctcggggcca tcgccgtgga gcatcactgc       360
     gccgtggtga gcctggacag ggatttcgcc cggtttgcct ctgtgcgcca tattcgcccg       420
     ccaatctag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page