(data stored in ACNUC1104 zone)

EMBL: CP000717.PE283

CP000717.PE283       Location/Qualifiers
FT   CDS_pept        complement(333754..335433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10283"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04626"
FT                   /protein_id="ABR04626.1"
FT                   /translation="MFFGSGGAGGAGGFGRTTGGIGGTGGNAGLLNGSGGAGGAGGAAI
FT                   TGPGGTGGAGGIPGLIGNGGNGGDGGASVTGTGGNGGAGGNGVQIGNGGNGGSGGTGAA
FT                   AGKAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAALNVVNEPFQTLTGRPLIGNGANGTP
FT                   GTGAAGGAGGWLFGNGGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGG
FT                   IGGAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGG
FT                   VPAGVGGAGGNGGLFANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGN
FT                   GGLFGAGGTGGAAGSGGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGTG
FT                   GNGALLFGFGGAGGAGGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALG
FT                   AGTGGTGGDGGHAGVFGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGH
FT                   ARCRRHRRAAARRERTQRLAIAGRPATTRGVEGISCSPQMMP"
     atgttcttcg gctccggcgg cgccggcggc gccggcgggt tcggccgcac caccggcggg        60
     ataggaggca ccggcggcaa cgccggcctg ctcaacggct ccggcggcgc cggcggcgcc       120
     ggcggcgctg ctatcaccgg tccaggcggc accggcgggg ccggtggcat acccggtttg       180
     atcggcaacg gcggcaacgg cggtgacggc ggcgccagcg tgaccggcac cggcggcaac       240
     ggcggagcgg gcggtaacgg cgtgcagatc ggcaacggcg gcaacggcgg cagcggcggg       300
     accggcgcag ccgcgggcaa ggccggcctc ggcggcctcg gcgggcagct aataggacta       360
     gacggatcca atgctccagt cagcacctca gtccataccc tgcagcaggc agcgctcaat       420
     gtggtgaatg agcccttcca gacattgact gggcgtccgc tgatcggcaa cggcgccaac       480
     gggaccccgg ggaccggggc tgccggcggg gccggcgggt ggttgttcgg caacggcggt       540
     aacggcgggc acggtgcgac caacaccgcc gccacggcta cgggcggggc cggcggggcc       600
     ggcgggatct tgttcggtac cggtggcaat ggcgggaccg gcgggatagc caccggtgct       660
     ggagggatcg gcggggccgg cggcgccggt ggggtctcct tgctgatcgg ctccggcggc       720
     accggcggca acggtgggaa ctccataggc gtcgctggca tcggcggggc cggcgggcgc       780
     ggcggcgacg ccggtttgct cttcggcgcg gccggcaccg gcggccacgg cgccgctggc       840
     ggtgtcccgg ccggcgtcgg cggcgccggc ggcaacggcg gactgttcgc caacggcgga       900
     gccggagggg ccggcgggtt caacgcagcc ggcgggaacg gcgggaacgg cggactgttc       960
     ggaactggcg gcaccggcgg ggccggcacg aacttcgggg ccggtgggaa cggcgggaac      1020
     ggcggactgt tcggagccgg cggcaccggc ggcgccgccg gctcgggagg gtccgggatc      1080
     accaccggcg gcggcgggca cggcggcaac gccggcctac tctccctcgg cgcctccggt      1140
     ggcgccggcg gcagcggtgg cgccagctcc cttgccggcg gggccggcgg aaccggcggg      1200
     aacggcgcct tactcttcgg cttcggcggc gccggcggcg ccggcgggca cggcggggca      1260
     gcacttacca gcatccagca aggcggcgcc ggcggcgccg gcgggaacgg cggcttgctc      1320
     ttcggctccg ccggcgccgg cggcgccggc ggcagcggtg ccaacgctct aggcgccggt      1380
     accggcggca ccggcggtga cggtggccac gccggggtgt tcggcaacgg cggtgacggg      1440
     ggttgccggc gggtttggcg ccggtaccgg cggcagcggt ggtgtcggcg gcaacgccgt      1500
     gctgatcggc aacggcggca acggcggcaa cgccggcaaa gccggggcca cgcccggtgc      1560
     cggcggcacc ggcgggctgc tgctcggcga gaacggactc aacggcttgc catagcaggc      1620
     agacctgcga ccacacgcgg cgttgagggc atcagttgct caccgcagat gatgccgtag      1680
//

If you have problems or comments...

PBIL Back to PBIL home page