(data stored in ACNUC1104 zone)

EMBL: CP000717.PE297

CP000717.PE297       Location/Qualifiers
FT   CDS_pept        356224..357642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10297"
FT                   /old_locus_tag="TBFG_00289"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0290"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04640"
FT                   /protein_id="ABR04640.1"
FT                   /translation="MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSA
FT                   QNGDGGQADSGAAVQLSLAPVGGQPFSLDASLDTVGVVDGDLLVLQPVPAGPAAPGIVE
FT                   DIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAG
FT                   IAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWS
FT                   LIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQ
FT                   AAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYT
FT                   ATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPV
FT                   MAYLVGLFAWVLNR"
     atgtccggca ccgtcatgca gatcgtccgc gtcgccattc ttgcggacag caggttgacc        60
     gagatggccc tgcccgcgga gttgccactg cgcgaaatcc tgcccgcggt acaacgcttg       120
     gtggttccct cggcgcaaaa cggcgatggt ggccaagccg actccggcgc tgccgtgcaa       180
     ctgagtttgg cgcccgtcgg cgggcagccg tttagcttgg atgccagcct ggacaccgtc       240
     ggtgtcgtcg acggtgatct gttggtgttg cagccggtgc ccgccggtcc ggccgcgccg       300
     ggcatcgtcg aagacatcgc cgacgccgcg atgatctttt cgacgtcgcg gttaaagccc       360
     tggggcatag cgcatatcca acgaggagcg ctggccgcgg tgattgccgt ggctctgctg       420
     gctaccggtt tgacggtgac ctatcgggtt gccaccggtg tgctggccgg gctgctggcg       480
     gtggccggga tcgcggtggc tagcgcgctg gccggattgt tgatcaccat ccgttcgcca       540
     cgttcgggta tcgcgctgtc gatcgccgcg ctggtcccca tcggcgcggc cctggcgttg       600
     gcggtgccag gaaagttcgg gccggcgcag gtattgctgg gtgcagctgg ggtagccgca       660
     tggtcgctga tcgcgctgat gattcccagc gccgaacggg aacgcgtcgt cgccttcttc       720
     accgcagcgg cggtggtcgg ggcgtcggtg gcgctggcgg ccggtgcgca attgctgtgg       780
     cagctgccgt tgttgagcat cggctgcggg ctgattgtgg cggcgctgtt ggtcaccatc       840
     caggcggctc agctttccgc actgtgggcg cggttcccgt tgccggtgat cccggcgccg       900
     ggggatccca ccccgtcggc cccgccgttg cgcctgctgg aggatttgcc tcggcgggtg       960
     cgggtcagtg acgcccatca aagcggcttc atcgccgcgg ccgtgctgct cagcgtgttg      1020
     gggtcggtgg ccatcgcggt gcgcccagag gcgctcagcg ttgtgggctg gtatctggtg      1080
     gcggcgactg cggccgcggc caccctgcgc gcgcgggtgt gggattcggc cgcatgcaag      1140
     gcgtggctgc tggctcagcc ctatctggta gccggggtcc tgttggtgtt ctacaccgcg      1200
     accggacgct atgtcgccgc gttcggcgcg gtgctggtgc tagccgtgct catgctggcc      1260
     tgggttgtgg tggcactgaa cccgggcatc gcttcgccgg agagctactc gctgccgctg      1320
     cgccggctgc tgggtttggt cgccgccggg ctggatgttt cgctgatccc cgtcatggcc      1380
     tacctggtcg gattgttcgc ttgggtgctc aacagatga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page