(data stored in ACNUC1104 zone)

EMBL: CP000717.PE308

CP000717.PE308       Location/Qualifiers
FT   CDS_pept        367746..368378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10308"
FT                   /old_locus_tag="TBFG_00300"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0302"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04651"
FT                   /protein_id="ABR04651.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
     gtgggcgttc ccgccaagaa aaaacagcag cagggggaga ggtcacgaga atcgattctc        60
     gacgcgaccg aacgcctgat ggcgaccaag ggctacgcgg cgacctcgat cagcgacatc       120
     cgcgacgcgt gcgggctagc acccagctct atttactggc acttcggctc caaagagggc       180
     gtgctggccg ccatgatgga gcgcggcgcg cagcgcttct ttgccgcgat acccacctgg       240
     gatgaggccc atgggcccgt cgagcagcga tccgagcgcc agctgaccga gctggtgagc       300
     ctgcagtcgc agcatccgga cttcctgcgc ctgttctacc tgctgtcgat ggaacgaagt       360
     caggatccgg cggttgccgc ggtggtgcgc cgggtccgca acaccgcgat cgcccgattt       420
     cgtgacagca tcacgcacct gctgccatcg gacatcccgc cgggcaaagc cgatctcgtc       480
     gtcgcggagc tgaccgcgtt cgcggttgcg ctgtcggacg gcgtctattt cgccggccac       540
     cttgaaccgg acacgaccga cgtcgagcgc atgtaccggc ggctgcggca agcgctcgag       600
     gccctgattc ccgtcctcct ggaggagaca tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page