(data stored in ACNUC1104 zone)

EMBL: CP000717.PE310

CP000717.PE310       Location/Qualifiers
FT   CDS_pept        complement(369291..378791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10310"
FT                   /old_locus_tag="TBFG_00302"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0303"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04653"
FT                   /protein_id="ABR04653.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNT
FT                   GMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPIT
FT                   ASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGA
FT                   TVVVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTT
FT                   SGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAG
FT                   TAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFG
FT                   NLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGI
FT                   GLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTN
FT                   TGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDV
FT                   DTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMG
FT                   VTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPL
FT                   ISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGA
FT                   LGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANH
FT                   GTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGN
FT                   FGDDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIG
FT                   FFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNT
FT                   GDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGV
FT                   DIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGI
FT                   TASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLN
FT                   VGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGF
FT                   GNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIG
FT                   IGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGST
FT                   STGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGD
FT                   VSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVV
FT                   DNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGL
FT                   GPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVS
FT                   GLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAG
FT                   LGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIA
FT                   NTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNV
FT                   GIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSINTGSFN
FT                   TGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFF
FT                   WRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGP
FT                   AAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTG
FT                   PSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLA
FT                   NLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAG
FT                   IGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNI
FT                   GLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQ
FT                   IGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAG
FT                   STNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFIT
FT                   GSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGL
FT                   SGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG"
     atggatttcg tggtgtcggc gcccgaggtc aattcgttac ggatgtatct cggggccgga        60
     tcggggccga tgttggcggc cgcggcggcc tgggacggac tagccgacga actggcggtg       120
     gcggcgtcgt ggtttgggtc ggtgacctcg ggcctggcgg atgcggcgtg gcgcggcccc       180
     gcggcggttg cgatggcgcg cgcggtagcc ccctacctgg gctggttgat ttcggcaacg       240
     gcccaggctg agcaggccgc cgctcaggca cgggtagccg tggccacgtt cgaggcggcg       300
     cgggcagcga cggtgcatcc ggcgatcgtc gcggccaacc gcgccgtgct ggtgtcgctg       360
     gtgagctcga atctgctggg attcaacgct ccggcgatcg cggccaccga ggccgcctat       420
     gagcggatgt gggcccagga tgtggccgcg atggttggct atcacgctgg agcgtcggcg       480
     gccgtctccg cgttgatgcc gttcacccag cagctgaaga agctggcggg cctatcggag       540
     cggctgacca gcgccgcggc agccgctgcc ggccccccga gcgcggcggg cttcaatctc       600
     ggcttggcaa acgtcggcgc caacaacgtg ggcaacggaa acgtcggcgt gttcaacgtc       660
     ggcttcggca atttgggcag ctacaacctc ggctttgcaa acctgggcag cgacaacctg       720
     ggtttggcca acctgggcgg ccacaacatc ggctttgcga acaccggcag caacaatgtc       780
     ggctttggga atacgggcag caacaatgtc ggcatcgggc tcaccggcaa cggacagatc       840
     gggttcggca gcttcaactc gggcagccac aacatcggcc tgttcaactc cggcagcgga       900
     aacgtcgggt tgttcaactc gggcaccggc aatttcggca tcggaaacag cggcaccgga       960
     aacttcggcc tcggcaacac gggcagcacc aacaccggct ggttcaacac cggcgacgtc      1020
     aacaccggcg gcttcaaccc gggcagctac aacaccggga acttcaacac cggcaactac      1080
     aacaccggca gcttcaacgc aggtaactac aacaccggct acttcaacac cggcgactac      1140
     aacactggag tggccaacac cggcaacgtc aacaccggcg ccttcatcgc cggcaactac      1200
     agcaacggcg tcttgtggcg gggcgactac caaggcctga tcggtgccga tatcgccctc      1260
     gagattcccg ccattccgat aaacgcgcag ctattcagca tgccgataca tcaggtgatg      1320
     gtcatgcccg gaagcgtgat gacgattccg ggcatgcgtt tgcccttcac atccattgtt      1380
     cccttcgttg tttactacgg cccggtcgag ctcccgcaat ccacgctcac ccttcccacg      1440
     gtgacgatca ccgtgggcgg accaaccacc acgatcgacg gcaacctcac cggcatggtg      1500
     gggggcgtca gcatcccgct catcaagatt ccggcggccc cgggcttcgg gaactcgacc      1560
     accagcccgt cgtcgggctt cttcaacgct ggcgccggca ccgcctcggg cttcggcaac      1620
     ttcggcggcg gcgcttcggg cttttggaac ctggcctcgg caacctcggg actttcgggc      1680
     ttcgggaacg tcggcgcgct gggatcgggt gtagctaacg ttggcaacac catctcgggt      1740
     ctctacaaca cgagcacgtc gaatctggcg acgccagcct ttaactccgg cctgctgcac      1800
     cacagcgtgg gcaccatgac ccttaacttc gggttggcaa acgtcggcgg caacaatgtc      1860
     ggcggtgcaa acgccggaat cttcaatgtg ggcttggcaa acctgggcga ctacaatatt      1920
     ggcttcggca atctaggcgg cgacaacctg ggcttcgccc acgcgggcag ctacaacatc      1980
     ggctttgcga acaccggcag caataatctt ggcttcgcga acacgggtga caacaatatc      2040
     ggttttgcga atatcggcag caacaatatc gggatcgggc tcaccggcag cggccagatc      2100
     gggttcggca gcctgaactc gggcagccac aatatcggct tgttcaactc gggtgacgga      2160
     aacatcggat tgttcaactc gggcagcgga aacttcggga taggaaacgc gggcaccgga      2220
     aactggggca tcggaaactc gggcgccgga aacttcggca tcgggaacgc gggcagcacc      2280
     aacacgggct tgttcaactc cggagacctc aacacgggta gcttgaaccc gggcagctat      2340
     aacaccggca gcgtcaacac cggcagcgtc aacaccggtg gcttcaatgc aggtaactac      2400
     aacaccggct acttcaacac cggcgactac aacaccggca tggcgaacac cggcaatatc      2460
     aacaccggcg ctttcatctc cggcaaccac agcaacggcc ttctgtggcg gggcgacaac      2520
     cagggtctga tcgacctcgc catcggcgtc gacattcccg aaatcccgat tgtgagcgtc      2580
     gacgtgaata tcccgattca cataccgatc accgccagct tcacggacat cgtatacagc      2640
     gggctcgatc ttccaccgaa cacagccgtc actgttattt ttttcggacc cgtcgatatc      2700
     gaccccttca ccgtcccagt gatacggata accggtccca cacctgtggt catggtgggt      2760
     ggacccacta ccgcgatcaa tatcggcgcc actgtggtcg tcgacgccat caacatcccg      2820
     attatccata ttccagcgac tccaggcttc ggcaactcga ccggcggact gtcgtcgggc      2880
     ttcttcaata gcggcgctgg cagcgcctcg ggcttcggca acttcggggg cgccgcgtcg      2940
     ggctttatga acctggtctc cacaacgtcg ggaatgtcgg gcttcctcaa cgtcggcgcg      3000
     ctgggatcgg gtgtggcgaa tgtgggcaac accatctcgg gtatctacaa cgtgggcacg      3060
     tcggacctct cgacgcccgc cgttaactcc gggttggcaa atatcggaac caatattgcc      3120
     ggcctgctgc gcgacggcgc gggtactgcg gctattaact tgggcttggc caaccacggc      3180
     aacctcaacg tgggcttcgc aagtctcggc ggctttaact tcggcggcgc caccatcggc      3240
     cacaacaacg tcggcatcgg gaacaccgga atcttcgatg tcggcctggc gaacctgggc      3300
     agctacaaca tcggcttcgg aaaccttggc gacgacaacc tgggcttcgg caacttcggc      3360
     agctacaaca tcggcttcgg caacgtcggc aacgacaatc tgggtttcgc taacgcgggc      3420
     ggcggcaaca tcggctttgc gaacaccggc agcaacaatg tcggctttgg gaacacgggc      3480
     agcaacaatg tcggcatcgg gctcacgggc aacggacaga tcgggttcgg cagcttcaac      3540
     tcgggcagcg gaaacatcgg cctgttcaac tcgggcagca acaacatcgg attcttcaat      3600
     tccggcagcg gcaacttcgg catcgcaaac tcgggcagct tcaacactgg catcggaaac      3660
     accggcaaca ccaataccgg cctattcaac tccggcgacg tcaacacggg cgccttcaac      3720
     ccgggcagct tcaacaccgg tagcttcaac accggcagct tcaacaccgg tggcttcaat      3780
     ccgggcaata ccaacaccgg ctacctcaac attggcaact acaacaccgg catcgccaac      3840
     accggcgacg ttgacaccgg ggctttcatc accggaaact acagcaacgg gttgttctta      3900
     agcggcgatt accagggcct ggtcggcctc aacctggtga tcgatatgcc tctccccata      3960
     agcctcggcg tgaatattcc catcgatatc ccgatcaccg cctcggccgg caacatcacc      4020
     cttatgggcg tcacgattcc gcccaccggc gatatcgtcc tttcgtcaat agcgggccag      4080
     cgagcccact ttggccccat taccattccg aacatcacgg ttgtcggccc cacgacgaca      4140
     gtcgccatag gagggccgaa taccgcgatc accataactg gcggtggcgc cattaggatc      4200
     ccgctcatca gtatcccggc ggcgccaggt ttcggaaact cgaccaccaa cccgtcgtca      4260
     ggtttcttca ataccggcgc cggcggcgcc tcgggcttcg gcaacttcgg cggcgccaat      4320
     tcgggctttt ggaacctggc ctccgcgacc tcgggggcgt cggggctcct caacgtcggc      4380
     gccctgggat caggtctggc gaacgtgggc accaccgtct cggggttcta caacaccagc      4440
     acgtcagacc tcgcgacgcc ggccttcaat tcaggcctgg ccaacatcag caccagtatc      4500
     gccggcctgc tgcgcgacag cacgggcacc atggtcctca acctgggctt ggcaaaccac      4560
     ggcaccctca acgtcggcat tgcaaacctc ggcgactaca acatcggctt tgcaaacctc      4620
     ggcagcgcca acttcggcag cgccaatatc ggtggcaaca acatcggcgg cgcaaacacc      4680
     ggaatattcg acatcggttt ggcaaatctg ggcagttaca acatcggctt cggaaacttc      4740
     ggcgatgaca acctgggctt cgccaacacc ggcagcaaca atatcgggtt cgcgaacacc      4800
     ggcagcaaca atatcggcat tgggctcacg ggcgacggcc agatcgggtt cggctccctg      4860
     aattctggca gcggaaacat cggcttgttc aactcgggca gcggaaacat cggctttttc      4920
     aactcgggca acggaaacgt tggcatcggc aacaccggca ccgcaaactt cgggcttgga      4980
     aacaccggca gcaccaacac cggcttcttc aactccggcg acgtcaatac cggtatcggc      5040
     aacaccggca gcttcaacac cggcagcttc aatccgggcg attccaacac cggggatttc      5100
     aacccaggca gctacaacac gggactcgga aacaccggcg atgttgacac cggcgccttc      5160
     atctccggca gctacagcaa cgggttcttg tggagtggaa attatcaggg cctcattggc      5220
     ttgcacgcgg cgctagcgat tcccgaaatc gccctaacct ttggcgtcga catcccgata      5280
     catataccca tcaacatcga cgccggggtc gtcaccctcc agggcttcag catcgtagct      5340
     gccgaaaata atatcgactt cacccccatc atcatcccga ccatcaatat caccttgccc      5400
     acggcggcga tcaccgtggg cggacccacc acctcgatcg gtatcaccgc cagcgccggt      5460
     atcggctcca tcaccatccc gatcatcgac attcccgcga catcgggctt cggcaactcg      5520
     accactagtc cgtcgtcggg cttcttcaac tccggagcgg gcagcgcgtc gggctttttg      5580
     aacgtggtcg ccggcgcctc agggatttcg ggttatctca atgtcggtgc gctggggtcg      5640
     ggtgtgacta acgtgggtca caccgtctcg ggtttctaca acgcgagcgc gttggacctc      5700
     gtgacgccgg cctttgcctc cggtctcatg cgcgacggta tgggcacgat gactctgaac      5760
     cttgggctgg caaacctggg cagcaataac gccggcttcg gcaacaccgg gatctttgac      5820
     gtcggcgtgg cgaatctggg caactacaac atcggcttcg gaaacttcgg cgacgacaac      5880
     ctgggctttg ccaacctagg cagctacaac atcggcgttg ccaacaccgg cagcaacaat      5940
     atcggctttg ccaacaccgg cagcaacaat atcggcatcg ggctcaccgg taccggccaa      6000
     atcgggatcg gcgctctgaa ctcgggcagc ggaaacatcg gcttgttcaa ctcgggcgac      6060
     ggaaacatcg gcttctttaa ctcgggcacc gggaacttcg gcatcggcaa caccggcacc      6120
     ggaaacttcg gcatcggcaa ctcgggcagc accagcacgg gcttgttcaa ctcgggcgac      6180
     ggcaacaccg gcggcttcaa ccccggtaac ttcaacaccg gcaatttcaa taccggcagc      6240
     ttcaacaccg gcggcttcaa cgcgggtaac accaacaccg gccacttcaa caccgggaac      6300
     tacaacaccg gcatcgcgaa tacgggcgac gtcagcaccg gcgctttcat ctccggcaac      6360
     tacagcaacg gcatcttgtg gcggggcgac taccagggcc tgatcggtta ctcctacgcg      6420
     ctgactattc cggagattcc ggcgcacttg gacgtcaata tcccaatcga cataccgatc      6480
     accggcagtt tcaccgacct cgtggtggac aatttcacta tccccatcat cggcttcgaa      6540
     tccttcgcgt ttagctttca catccatacc gagccggaca tcggtcccat cattgtcccg      6600
     agcttcgtgc tcagcgttcc cacgttcgcg atcgccgtgg gcggacccac gaccgcgatc      6660
     aacatcagcg ccaccgccgg cctcggcccc atcaccatcc cgatcatcga cattccggca      6720
     gcgccgggca tcggaaactc gaccaccagc ccgtcgtcag gcttcttcaa caccggcgcc      6780
     ggcaccgcat ccgggttcgg caacgtcggc ggcaacacat cgggcctgtg gaaccttgcg      6840
     tcggcagcct caggagtctc gggcttgctc aacgtcggcg cgttgggatc gggtgtggcg      6900
     aatgtgggca acaccatctc gggtatctac aacacgagcc cgctggacct cgggacgccg      6960
     gccttcggct ccggcctcgc aaacatcgcc ggcctgctgc agggcggcgc cggcacgacg      7020
     atcctcgact tggccggcct cggcaacctc aatgtcggct tggcaaacct cgggggctct      7080
     aacttcggga tcgggaacac cggaatcttc aatgtcggtt tcgcaaacgt gggcaaccac      7140
     aacattggct tggcaaacct gggcaactac agcgtcggct tcgccaactc gggcaactac      7200
     catatcggca ttgctaacac cggcagtgcc aatatcggct tcgccaacac cggtagcggc      7260
     aatatcggca tcgggctcac cggcaccggt cagatcgggt tcggcagctt caactcgggc      7320
     agccacaaca tcggcttgtt caactccggt gacggaaacg taggattctt caactcgggc      7380
     accggcaacg tgggcatcgg aaacaccggc accgcaaact tcggcatcgc aaactcgggc      7440
     agcttcaaca ccggcctcgg gaacacgggc agcaccaaca cgggcctgtt caacccgggc      7500
     aacgtcaaca ccggcgtcgg caacaccggc agcatcaaca ccggcagcat caacaccggc      7560
     agcttcaaca ctggcagcac caataccggc agcttcaacc tcggcgatca caacaccggc      7620
     agcttcaact ccggtgacta caacacgggc tacttcaacg cgggtgacta caacacgggt      7680
     gtggccaaca cgggcaacgt caacaccggc gcgttcatct ccggcaatta cagcaacggg      7740
     ttcttctggc gaggtgacta ccaggggttg attggccttt ccacaacgat caccattccc      7800
     gaaatcccct accgctacga cttgagtgtt ccaatcgaca tacccatcac cggcaccgtc      7860
     gtcgccacca cgccaaacag tttcaccatt cccggtttcc agatacgagt cttgcttggt      7920
     cctgcggcgg tgcttgtcaa cgagatgatc ggccccatca cgatcgatgt caatcaagtc      7980
     atcgccatcg attcgcccat tcagcaaacc atcagcatgg ttggcaccgg cggcttcggc      8040
     ccgatcccca tcggcatcag catcggtggt accccgggtt tcggcaactc gaccaccggc      8100
     ccgtcgtcgg gtttcttcca caccggcgcc ggccatgtat cgggcttcgg gaacttcggc      8160
     gccggcaaca tgtcgggctc cgggaacttc ggcgctggca attcgggctt ctttaacgcc      8220
     ggcggcttgg gcaattcggg cctactgaat ttcggcgcgc tgcagtcggg tctggcgaac      8280
     ctgggcaaca ccatctcggg cgtctacaac acgagcacgc tggacctcgc gacgcccgcc      8340
     ttcggctcgg gcatcgcaaa catcggcgcc aacctggccg gcctgttcct cgacaacacc      8400
     ggcaacctga cgctgaactt cggcgtcgca aaccagggcg gcctcaacgc gggcatcggg      8460
     aacctgggca gcgtcaacat cggcttcgtt aataccggcg actccaacct gggcatcggc      8520
     aacctcggcg acctcaactt cggcggggtc aacatcggcg gtaacaacat cggcatcgcc      8580
     aacaccggga tcttcgatat cggcttggcg aacctgggca gctacaacat cgggttggca      8640
     aatctgggcg acgacaacct gggctttggc aacgccggca gctacaacat cggcttcgcg      8700
     aacttcggca gcgacaacct gggctttgcc aacaccggca gctacaacat cggcttcgcg      8760
     aataccggta acaacaacat cggcgtcggg ctcaccggca acggccagat cgggatcggc      8820
     agcctcaact cgggcagcaa caacatcggg ctgttcaact ccggcagcgg aaacatcggg      8880
     ttcttcaact cgggcaccgg caacgtcggc atctttaaca ccggcaccgg caacttcggt      8940
     ctcgcgaact cgggcggctt caacaccggc atcggcaacg cgggcagcac caacacgggc      9000
     gtgttcaacc ccggggacct caacaccggc agcttcaacc cgggcagctt caacaccggc      9060
     ggcttcaacc cgggcagtgg caacacgggc tacctcaaca ccggtgacta caacacgggc      9120
     gtggcgaaca cgggcgatgt ggacaccggt gcgttcatta ccggcagcta cagcaacggc      9180
     ttcttggtga gtggcgacta tcagggcctg atcggcctgc cgctgttggg cattccggtg      9240
     acccccggct acttcaacct cactggcggc ccgtcgtcgg gcttcttcaa cagcggcgcc      9300
     ggaagcgtat cgggattcgt gaactccggt gccggcctgt cgggctacct caataccggc      9360
     gcgctgggat cgggtgtcgc caacgtgggc aacaccatct cgggctggtt gaacgccagc      9420
     gcgctggatc tcgcgacgcc ggggttcctt tccggcatcg gtaactttgg caccaacctg      9480
     gcgggtttct ttaggggata a                                                9501
//

If you have problems or comments...

PBIL Back to PBIL home page