(data stored in ACNUC1104 zone)

EMBL: CP000717.PE312

CP000717.PE312       Location/Qualifiers
FT   CDS_pept        complement(379653..380135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10312"
FT                   /old_locus_tag="TBFG_00304"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0307c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04655"
FT                   /protein_id="ABR04655.1"
FT                   /translation="MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIP
FT                   GLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQ
FT                   LDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP"
     atggctgtca ttgttcgcaa gtggtttggt ctcggcaggc tgcctgctga cctacgctgt        60
     caggttgagg ctgagggact catctacctt gccgaatacg tggccgtcac caggcggttc       120
     accggcgtta tcccggggct gcgggcatcg cacagcatcg ccagctacgt gggtgcgctg       180
     gcgttcaccg aacagcgggt gctgggaacc ctgtcgatgg tgccgaagct agccggccgg       240
     gtcgtcgacg cgcgctggga cgggccgcag gccggtgccg cgaccgccga aatctcgccg       300
     acgggtctgc aactcgatct cgatgtcgcc gatgtcgacc cgaagttcag cggccagctc       360
     gcgctgcact tcaaggccac tatcggtgaa gatgtgttga gccgcttgcc gcggcgatcg       420
     ctggcctttg acgtgccggc cgaatacgtc aacctcgcgg tcggcgtgac ctattcgccg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page