(data stored in ACNUC1104 zone)

EMBL: CP000717.PE314

CP000717.PE314       Location/Qualifiers
FT   CDS_pept        381011..381667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10314"
FT                   /old_locus_tag="TBFG_00306"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0309"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04657"
FT                   /protein_id="ABR04657.1"
FT                   /translation="MSRLLALLCAAVCTGCVAVVLAPVSLAVVNPWFANSVGNATQVVS
FT                   VVGTGGSTAKMDVYQRTAAGWQPLKTGITTHIGSAGMAPEAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCQKSQCPFSTADSENLQIPQYKHS
FT                   VVMGVNKAKVPGKGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
     atgagccgac tcctagcttt gctgtgcgct gcggtatgca cgggctgcgt tgctgtggtt        60
     ctcgcgccag tgagcctggc cgtcgtcaac ccgtggttcg cgaactcggt cggcaatgcc       120
     actcaggtgg tttcggtggt gggaaccggc ggttcgacgg ccaagatgga tgtctaccaa       180
     cgcaccgccg ccggctggca gccgctcaag accggtatca ccacccatat cggttcggcg       240
     ggcatggcgc cggaagccaa gagcggatat ccggccactc cgatgggggt ttacagcctg       300
     gactccgctt ttggcaccgc gccgaatccc ggtggcgggt tgccgtatac ccaagtcgga       360
     cccaatcact ggtggagtgg cgacgacaat agccccacct ttaactccat gcaggtctgt       420
     cagaagtccc agtgcccgtt cagcacggcc gacagcgaga acctgcaaat cccgcagtac       480
     aagcattcgg tcgtgatggg cgtcaacaag gccaaggtcc caggcaaagg ctccgcgttc       540
     ttctttcaca ccaccgacgg cgggcccacc gcgggttgtg tggcgatcga cgatgccacg       600
     ctggtgcaga tcatccgttg gctgcggcct ggtgcggtga tcgcgatcgc caagtaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page