(data stored in ACNUC1104 zone)

EMBL: CP000717.PE315

CP000717.PE315       Location/Qualifiers
FT   CDS_pept        complement(381737..382228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10315"
FT                   /old_locus_tag="TBFG_00307"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0310c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04658"
FT                   /protein_id="ABR04658.1"
FT                   /translation="MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDV
FT                   TGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDR
FT                   VIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
FT                   "
     gtgtgctgca atggcgtggt gactccgggt gatccagccg acattgcagc gatcaaacag        60
     ctcaaatacc ggtatctgcg ggcattggac accaagcatt gggacgactt caccgacacc       120
     ctggccgagg atgtcaccgg cgattacggg tcatcggtcg gtacggagct gcacttcacc       180
     aaccgcgccg acctggtcga ctacctgcgc caggcactcg gcccgggtgt catcaccgaa       240
     caccgggtca cccatccgga aatcaccgtg accggcgata ccgcaaccgg catctggtac       300
     ctgcaagacc gggtcatcgt cgccgagttc aatttcatgc tcatcggcgc cgcgttctac       360
     cacgaccagt accgacgaac caccgacggc tggcggatca gcgccaccgg ctacgaccga       420
     acctacgagg cgaccatgtc gttggcgggc cttaacttca acatcaggcc gggccgcgcg       480
     ctggccgatt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page