(data stored in ACNUC1104 zone)

EMBL: CP000717.PE316

CP000717.PE316       Location/Qualifiers
FT   CDS_pept        382252..383481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10316"
FT                   /old_locus_tag="TBFG_00308"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0311"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04659"
FT                   /protein_id="ABR04659.1"
FT                   /translation="MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEM
FT                   LQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWH
FT                   GEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPAD
FT                   RHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLD
FT                   FGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAE
FT                   RIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTP
FT                   ASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFE
FT                   PRRSLPLTVK"
     atgagccaat cccggtacgc ggggttgtcc cgcagcgagc tggcagttct gttacccgag        60
     ctgttgttga tcggccagct gatcgaccga tcgggcatgg cctggtgtat acaggcattc       120
     ggccgccagg agatgctgca gatcgccatc gaggagtggg cgggcgccag cccgatctac       180
     accaagcgca tgcaaaaggc gctgaacttc gagggcgacg acgtgcccac catcttcaag       240
     gggctacagc tcgacatcgg cgcgccgccg caattcatgg acttccgttt caccctgcac       300
     gaccgctggc acggcgagtt tcacctcgac cactgcggtg cgctgctcga cgtggagccg       360
     atgggcgacg actacgtcgt cggcatgtgc cacaccatcg aagatccgac gttcgacgcc       420
     accgcgatcg cgaccaaccc gcgcgcgcag gtgcgcccca tccaccggcc gccccgcaag       480
     ccggccgacc ggcatccgca ctgtgcgtgg accgtcatca tcgacgagtc ctatcccgag       540
     gctgagggta ttccggcgct ggacgcggtc cgtgaaacca aagctgccac ctgggaatta       600
     gacaacgtcg atgcgtctga cgacgggctg gtggactatt cgggtccgct ggtgtccgac       660
     ctggacttcg gggcgttctc gcattccgca ctggtgcgga tggccgatga ggtctgcctg       720
     caaatgcacc tgctgaatct gtcgttcgcc attgccgtgc ggaaacgggc caaagccgat       780
     gctcaactgg ccatttcggt gaacacccgc cagttgatcg gagtggccgg gctgggcgca       840
     gaacgcattc accgtgcgat ggctttaccc ggcggaatcg aaggcgcgtt aggtgtgctg       900
     gagctacacc cgctgctcaa cccggccggt tacgtgctgg ccgaaacgtc gccggaccgt       960
     ctggtggtgc acaactcgcc agcccacgcc gacggcgcct ggatttcgtt gtgcacaccg      1020
     gcatccgtgc agccgttgca ggccatcgcc accgctgtag acccgcatct gaaggttcgg      1080
     atcagcggga cggacaccga ctggaccgcg gaactcatcg aggccgatgc cccagcgagc      1140
     gaactgccgg aggtgttggt agccaaggtc agtcgcggat cggtcttcca gttcgagccg      1200
     aggcgctcac tgccgttgac cgtgaaatga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page