(data stored in ACNUC1104 zone)

EMBL: CP000717.PE319

CP000717.PE319       Location/Qualifiers
FT   CDS_pept        complement(385959..386621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10319"
FT                   /old_locus_tag="TBFG_00311"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0314c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04662"
FT                   /protein_id="ABR04662.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
     atgatcgtcg tgtgggagca tctgtgcatg aacccagagg atgacccgga ggcgcgaatc        60
     cgggaactgg agcggccgct agccgacgtg gcacgcgcct ccgaactcgg cggctcgcag       120
     tcgggcggct acacctatcc acccggcccg ccaccgccgc cgtatagcta tggcggcccg       180
     ttcggcggcc catcgccgcg atcgtcctcc ggcaacaggg cgtggtggat cctggccgcg       240
     gtcgtcgttg tcggcgtgct ggttctggtg ggtggcatcg ccgcattcag cgcacagcgg       300
     ctttcccaag gcaacttcgt cgttctctcg cccaccccgt ctgtctcccg ggctgttcca       360
     accccgactg cgcaaccggc caccactctt ccgccggccg gcgccagcct gagcgtctcc       420
     ggcgtcaacg tgaaccggac aatcgcctgc aacgacagca ttgtcagcgt cagcggcatg       480
     tccaacacgg tggtgatcac cggccactgc accagcctca ccgtgtccgg catgaggaac       540
     tcggtcaccg tcgactccgt cgacaccatc gaagccgccg gcttcaacaa cgaggtcacg       600
     tatcactcgg gctcgccgaa gatcagcaat gccggcggtt ccaacagcgt ccagcagggc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page