(data stored in ACNUC1104 zone)

EMBL: CP000717.PE329

CP000717.PE329       Location/Qualifiers
FT   CDS_pept        394432..395112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10329"
FT                   /old_locus_tag="TBFG_00321"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   arsR-family"
FT                   /note="Mapped to H37Rv Rv0324"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04672"
FT                   /protein_id="ABR04672.1"
FT                   /translation="MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIA
FT                   TATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADV
FT                   AVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADR
FT                   LAELTGDRDIVAYCRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPV
FT                   GHGD"
     atggctggac agtccgatcg taaggcggcg ttgttggacc aggtagcgcg cgtgggcaag        60
     gcgctggcca atgggcggcg attgcaaatc ctggacttgc tcgcccaagg tgagcgcgcg       120
     gtagaagcga tcgcgacggc gaccgggatg aacctgacca cggcatcggc gaatctgcag       180
     gcgctgaaga gcggcgggct ggtcgaggct cgccgcgagg ggacccggca gtactaccgg       240
     attgctgggg aagacgtggc aaggctgttc gcgctggtgc aagtggttgc cgacgagcat       300
     ctggccgacg tggcggtcgc ggccgcagac gtgctcggtt cgccggagga tgcgatcacc       360
     cgtgcggagc tgctgcggcg gcgcgaagcc ggcgaggtca ccctggtcga cgtgcgaccg       420
     cacgaggaat accaggccgg ccatatcccg ggcgccatca atatcccgat agccgaactg       480
     gccgaccggc tcgccgaact aactggcgac cgcgacattg tcgcctactg tcgtggtgcc       540
     tactgcgtca tggcccccga tgccgtccgc atcgcgcgcg acgcggggcg ggaggtgaaa       600
     cgcctcgacg acggaatgct cgaatggcga ttggccggac tgccggtcga cgagggtgca       660
     ccggtcgggc atggggattg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page