(data stored in ACNUC1104 zone)

EMBL: CP000717.PE33

CP000717.PE33        Location/Qualifiers
FT   CDS_pept        36968..37363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10033"
FT                   /old_locus_tag="TBFG_00033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0034"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04376"
FT                   /protein_id="ABR04376.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
     atgaccgacg acgccgatct tgatctggtc cgaagaactt tcgccgcgtt tgcccgcggc        60
     gacctcgccg agctgacgca atgctttgcg cccgacgtgg agcagtttgt cccgggcaag       120
     cacgccctgg ctggggtgtt ccgcggcgtg gacaacgtgg ttgcgtgcct cggcgacacc       180
     gcggccgccg ccgacggcac catgacggtg acgcttgaag acgtgttaag caacaccgat       240
     ggccaggtga tcgccgtgta tcgattgcgg gccagcaggg ccgggaaggt cctcgaccag       300
     cgcgaggcga tcctggttac cgtcgccggt ggtcggatca cccgacttag cgagttttac       360
     gccgacccgg cggcgaccga aagcttctgg gcatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page