(data stored in ACNUC1104 zone)

EMBL: CP000717.PE330

CP000717.PE330       Location/Qualifiers
FT   CDS_pept        395119..395343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10330"
FT                   /old_locus_tag="TBFG_00322"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0325"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04673"
FT                   /protein_id="ABR04673.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAG"
     gtggggccga agggaagtct acgtttggtg aagcggcagc cagaactgct cgttgcccag        60
     catgaacact ggcaggacac ctaccgagcg catccggtgc tgtacggaac ccgcccgtca       120
     gagccggggg tatatgccgc cgaggtgttc aatgccgacg gcgtgcagcg ggtgctggag       180
     ttggcggccg gtcatgggcg tgacaccctg tatttcgctg gctag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page