(data stored in ACNUC1104 zone)

EMBL: CP000717.PE346

CP000717.PE346       Location/Qualifiers
FT   CDS_pept        412442..413881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10346"
FT                   /old_locus_tag="TBFG_00338"
FT                   /product="isoniazid inductible gene protein iniB"
FT                   /note="Mapped to H37Rv Rv0341"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04689"
FT                   /protein_id="ABR04689.1"
FT                   /translation="MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSV
FT                   AANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLA
FT                   SGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLG
FT                   AQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGA
FT                   GVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGA
FT                   AMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGG
FT                   VGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGM
FT                   NPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPV
FT                   THTPPAPIELPSYGLFGLPGF"
     atgacctcgc ttatcgatta catcctgagc ctgttccgca gcgaagacgc cgcccggtcg        60
     ttcgttgccg ctccgggacg ggccatgacc agtgccgggc tgatcgatat cgcgccgcac       120
     caaatctcat cggtggcggc caatgtggtg ccgggtctga atctgggtgc cggcgacccc       180
     atgagcggat tgcggcaggc cgtcgccgct cggcatggct ttgcgcagga cgtcgccaat       240
     gtcggcttcg ccggtgacgc gggcgcgggg gtggcaagcg tcatcacgac cgatgtcggt       300
     gcgggcctgg ctagcggact gggtgctggg ttcctgggtc agggtggcct ggctctcgcc       360
     gcgtcaagcg gtggtttcgg cggtcaggtc ggcttggctg cccaggtcgg tctgggtttt       420
     actgccgtga ttgaggccga ggtcggcgct caggttggtg ctgggttagg tattgggacg       480
     ggtctgggtg ctcaggccgg tatgggcttt ggcggcgggg ttggcctggg tctgggtggt       540
     caggccggcg gtgtgatcgg tgggagcgcg gccggggcta tcggtgccgg cgtcggcggt       600
     cgcctaggcg gcaatggcca gatcggagtt gccggccagg gtgccgttgg cgctggtgtc       660
     ggcgctggtg tcggcggcca ggcgggcatc gctagccaga tcggtgtctc agccggtggt       720
     gggctcggcg gcgtcggcaa tgtcagcggc ctgaccgggg tcagcagcaa cgcagtgttg       780
     gcttccaacg caagcggcca ggcggggttg atcgccagtg aaggcgctgc cttgaacggc       840
     gctgctatgc ctcatctgtc gggcccgtta gccggtgtcg gtgtgggtgg tcaggccggc       900
     gccgctggcg gcgccgggtt gggcttcgga gcggtcgggc acccgactcc tcagccggcg       960
     gccctgggcg cggctggcgt ggtggccaag accgaggcgg ctgctggagt ggttggcggg      1020
     gtcggcgggg caaccgcggc cggggtcggc ggggcacacg gcgacatcct gggccacgag      1080
     ggagccgcac tgggcagtgt cgacacggtc aacgccggtg tcacgcccgt cgagcatggc      1140
     ttggtcctgc ccagtggccc cctgatccac ggcggtaccg gcggctatgg cggcatgaac      1200
     ccgccagtga ccgatgcgcc ggcaccgcaa gttccggcgc gggcccagcc gatgaccacg      1260
     gcggccgagc acacgccggc ggttacccaa ccgcagcaca cgccggtcga gccgccggtc      1320
     cacgataagc cgccgagcca ttcggtgttt gacgtcggtc acgagccgcc ggtgacgcac      1380
     acgccgccgg cgcccatcga actgccgtcg tacggccttt tcggactacc cgggttctga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page