(data stored in ACNUC1104 zone)

EMBL: CP000717.PE352

CP000717.PE352       Location/Qualifiers
FT   CDS_pept        420384..421370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10352"
FT                   /old_locus_tag="TBFG_00344"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0347"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04695"
FT                   /protein_id="ABR04695.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
     gtgcccggcg cgcgcgagtt gacgctgcgc gtcgagcgcg gggctctatt tcggcgtcga        60
     tgggcagcat cggcagcgtc atcagctcgc gcagcaattc gtcgtgatcc gcggcgctgc       120
     gcgctgggta cccggcctcg atgggtatca tttttggtta tcgttctggt tatcatgaat       180
     gttgtgacgg cccatcccaa gtacccgaat gaccctcttg cgctggtatt gattgaactg       240
     cgccatccgc ggaccgagcc gccggtgcca tctgctatct ccatcctgaa ggaggagctg       300
     gcgcgatgga ctcccatact cgaacaggag gaggtgcggc aggtcaacct agaaacgggc       360
     gaacataccg cacactcaca gaagaagctc gttgcccgtg atcgccgcac cgcgatcacg       420
     tttcgacccg acgccatgac cctcgaagtc accgactacc cgggctggga ggagtttcgg       480
     tccatcgttc acgcgatggt cacagcccgc caggacgtgg ccccagtcga tggctgcatc       540
     cggatcggtc tgcgctacat caacgagatt cgggcatcgc tggcggagcc atccggctgg       600
     gcgtactggg tggcggaaag tctcctcggg cctgggacac agcttgccga tctcaaactc       660
     accaccaccg cgcaacggca cgtcattcag tgcgaaggcc cggagccagg cgactccttg       720
     acactgaggt acgccggtgc gcgcggcgcg gtcatccagt caaccccgtt tctccagcgg       780
     ttgaaagaac ctccggcaga aggagatttc ttcctcatcg atatcgacag cgcgtggagc       840
     gacccctgca agggcatccc agcgctcgac gcccacctgg tggacgaggt cgccgaaagg       900
     ctccacacac ccatcggccc actgttcgaa tcgctgataa cttccgaact ccgtacaaag       960
     gtgctgcaac aacctgggca ggagtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page