(data stored in ACNUC1104 zone)

EMBL: CP000717.PE353

CP000717.PE353       Location/Qualifiers
FT   CDS_pept        421373..422026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10353"
FT                   /old_locus_tag="TBFG_00345"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0348"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04696"
FT                   /protein_id="ABR04696.1"
FT                   /translation="MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQ
FT                   FTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPA
FT                   ITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERG
FT                   RYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR"
     atgaccattt cgttctctag ctcgaatctc cgagacgacg ccacctctgg caacggcgat        60
     taccgcctcg acaagctgcc cgaaaccacc ccatcgacct cggtgttcga ccgcgccgat       120
     gtcacctacc gccaattcac ggaactccac gggcaagccc gcgacacacg gcgggaggcg       180
     cacgtggttg agctggagtc caagaccggc gagcgggctc ggtgcgcacc catgcatgcg       240
     cttgagcagc tcgcggacta cggctttgcc tggcgggaca tcgcacgcgt tgtcggagtg       300
     agcgtgcccg caatcaccaa atggcgcaag ggcgctggag ttaccggcga gaaccggcta       360
     aaaatcgccc gtctactcgc cctcatcgac atgctctcgg accgattcat cggcgagccc       420
     gcctcctggc tggaaatgcc gatccaagcc ggagtgggaa tcacccgaat ggacctcctg       480
     gagcgaggtc gatatgacct cgtattggcg ctggctagta cccacactgg ggacggtacg       540
     gtcgaatacg tactgaacga gactgataag gactggcgag agaccgttgt agacaacgct       600
     ttcgaatcct acacagccga ggacggcgtg atctcgataa gacccaagcg gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page