(data stored in ACNUC1104 zone)

EMBL: CP000717.PE361

CP000717.PE361       Location/Qualifiers
FT   CDS_pept        complement(437998..438627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10361"
FT                   /old_locus_tag="TBFG_00353"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0356c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04704"
FT                   /protein_id="ABR04704.1"
FT                   /translation="MHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQDLAVAA
FT                   DPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTRYGTDG
FT                   VEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRRITPID
FT                   VPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
     gtgcaccccg acgaactcga tcccgagtat caccaccacg gtggatttcc ggagtacggt        60
     ccggccagtc ccggtgcggg gttcggccag ttcgtggcga ccatgcgccg gttgcaggac       120
     ctggcggtcg cggcggaccc cggcgacgcc gtgtgggacg aggcggccga gcgcgccgcc       180
     gcgctcgtcg agttgctgag cccatttgag gccgacgaag gcaaggcgcc ggccgggcgg       240
     acccccggcc tgcccggcat gggcagcctg ctgctaccgc catggacggt gacccggtac       300
     ggcaccgacg gtgttgagat gcgggggtcg tttagccggt ttcacgtcgg gggcaactcc       360
     gcggtgcacg gcggcgtgtt gccgctgttg tttgatcaca tgttcggcat gatctcgcat       420
     gcggcgggac ggccgatcag ccggaccgcc tttctgcacg ttgattaccg ccgaatcacc       480
     ccgattgatg tgccgttgat cgtacgcgga cgagtcacca ataccgaggg ccgaaaggcg       540
     tttgtgtgcg cggaactgtt tgacagcgac gagacgctgt tggccgaagg caacggcctg       600
     atggtgcggc tactgcccgg ccagccctag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page