(data stored in ACNUC1104 zone)

EMBL: CP000717.PE363

CP000717.PE363       Location/Qualifiers
FT   CDS_pept        440028..440675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10363"
FT                   /old_locus_tag="TBFG_00355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0358"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04706"
FT                   /protein_id="ABR04706.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
     atgtatacgg ccgagaacgc acccggcgtc gcggtgttgc tctccggtga tgccgacgtg        60
     cccggcccgt tgaccggctt gcctacccat caagacaacc tggacaccgt catcggacgg       120
     tattcgcggc tcatcgtcgt cggcgccgac gcggacctgg gggcggtact gactcggctg       180
     ttgcgcaccg accggctcga cgtcgaggtg ggttatgtgc cgcgccggcg cagccccgcg       240
     acccgggcct accgcttgcc ggccgggcgc cgggcggcgc ggcgcgcccg gtgtggcgtc       300
     gctcggcggg tgccgctaat ccgtgacgag accgggtcgg taatcgtcgg ccgagcacag       360
     tggctgccgg ccgaagagca ggccctgatc cacggcgagg cggtcgttga cgacaccgtg       420
     ctgttcgatg gcgatgtggc cggggtgtgc atcgagccga cgctgaccct gccaggcctg       480
     cgagctgcgg tagacggcgc cggaaagtgg cggcggtgga tcggcgggcg cgccgcgcag       540
     ctaggcacca ccggtgctgc ggtacttcgg gacggtgtcg cggcgccccg cccggtgcgc       600
     cgatcgacgt tttaccgcaa cgtcgagggt tggctgctgg tccggtag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page