(data stored in ACNUC1104 zone)

EMBL: CP000717.PE369

CP000717.PE369       Location/Qualifiers
FT   CDS_pept        445563..446246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10369"
FT                   /old_locus_tag="TBFG_00361"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0364"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04712"
FT                   /protein_id="ABR04712.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
     atgagcaccg ccgtgacggc catgccggac atcctcgacc cgatgtactg gttgggcgcc        60
     aacggcgtat tcggttccgc ggtgctgccc gggattttga tcatcgtctt catcgagacc       120
     ggtctgctgt ttccgctgct gccgggcgag tcgctgttgt tcaccggcgg gctgttgtcc       180
     gctagcccgg caccaccggt caccatcggg gtgctcgccc cgtgcgttgc gctggtcgcg       240
     gtgctcggcg atcagaccgc atatttcatc gggcgacgga tcgggccggc gctgttcaag       300
     aaggaagact cccggttctt caagaaacac tatgtgaccg agtcccacgc gttttttgag       360
     aagtacggga aatggacgat aattctggct cgattcgtgc cgatcgcgcg gacttttgtg       420
     ccagtcattg ccggggtgtc ctacatgcgg tatccggtgt tcctcgggtt cgacatcgtc       480
     ggcggagtcg cctggggtgc gggtgtgacg ttggcgggct actttttggg cagtgtcccg       540
     ttcgtgcaca tgaactttca gctcatcatc ctggccatcg tgttcgtctc actgttgccc       600
     gcactggtct cggcggcgcg ggtctaccgg gcgcggcgta acgcacccca gagcgacccc       660
     gacccgttgg tgttacccga gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page