(data stored in ACNUC1104 zone)

EMBL: CP000717.PE37

CP000717.PE37        Location/Qualifiers
FT   CDS_pept        41405..42013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10037"
FT                   /old_locus_tag="TBFG_00037"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0038"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04380"
FT                   /protein_id="ABR04380.1"
FT                   /translation="MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVE
FT                   HNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADP
FT                   EGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLS
FT                   ALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN"
     gtggtggcgc cgcacgaaga ccccgaggac catgtcgcac ccgccgcaca acgggtgcga        60
     gcgggcacct tattgttggc caacaccgat ctccttgaac cgacatttcg ccgcagtgtg       120
     atctacatcg tggagcacaa cgacggcggc accctcggtg tggtcctcaa tcggcccagc       180
     gaaaccgcgg tctacaacgt gttgccgcag tgggccaaac tcgcggccaa gccaaagaca       240
     atgttcatcg gtgggccggt gaagcgcgac gcggcgctgt gtctggcggt attgcgggtt       300
     ggcgctgacc cggaaggcgt gccgggccta aggcatgtcg cgggcaggct ggtgatggtc       360
     gatctggatg ccgaccccga ggtgctcgca gcggcggtgg aaggggtgcg catctacgcc       420
     gggtactccg gctggaccat cggtcagctc gaaggtgaaa tcgagcgcga cgactggatt       480
     gtgttgtcgg cgttgccatc tgacgttttg gtggggccga gagccgacct gtgggggcag       540
     gtgctgcgac ggcagccgct gccgctgtcg ctgctggcca cccacccgat cgatctgagc       600
     cggaactag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page