(data stored in ACNUC1104 zone)

EMBL: CP000717.PE370

CP000717.PE370       Location/Qualifiers
FT   CDS_pept        complement(446235..447365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10370"
FT                   /old_locus_tag="TBFG_00362"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0365c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04713"
FT                   /protein_id="ABR04713.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
     atgaatctgg caaaccgggc agccagcgcc gaaaccgccg tcacgcaacg gcatctgaga        60
     cggctttggg cgttgccggg cacccagttg gcggtggtgg cttggccgtc aacccggcgc       120
     gaccggttgt tcggcagctg gcactactgg tggcaggcac acctgctgga ttgcctggtc       180
     gacgcgcagc tgcgcgaccc gcagccgcag cggcgcgccc ggatcaaccg ccaggtccgc       240
     tcgcaccggg tccgcaacaa tttctcgtgg ctcaacagct attacgacga catggcgtgg       300
     ctagcgttag cgctggaacg tgccgaccgg gtcgccgggg tacgacgccg gcgcgcactg       360
     cccaagctca ccaaccagtt cgtcgaagcc tgggtgcccg aggacggcgg cggcatcccg       420
     tggcgcaagc aggaccagtt cttcaacgcc ccagccaacg gcccggccgg gctattcctg       480
     gcccgctacc cagaccagta cgggaaaagg ctcaagcgcg cagaacagat ggccgactgg       540
     atcgatcgca cgctgatcga tccggagaca cacctggtat tcgacggcat caaggccggg       600
     tcgttggtcc gcgcgcagta cacctactgc caaggggtgg tgctcgggct ggaaaccgag       660
     ctggcggtgc gcaccggtcc ggcagccaga gcgcggcact gcgctcgcgt tcatcgcttg       720
     gtcgcggccg tcaacgagca catggctcca ttgggtgtgt tacggggcgc cggcggcggg       780
     gacggtggcc tgttcgcggg gatcaccgcc cgatacctcg ccttggtcgc caccacgttg       840
     ccgggcgact cggccgacga cgccgccgcc cgcgacaccg cccgcgcgat agtgctggct       900
     agcgcgcaat cggcgtggga ttaccggcaa accgtggacg ggttgccggt gttcggggcg       960
     ttctgggatc gcgaagccga gttgcccacc gccggcggtg agcaggcgcg gtccgtccga      1020
     ggagcggtgc atagctcggc gattgccgag cgagatctgt cggtgcagct atcgggttgg      1080
     atgctgatgg aagccgccca cagcgccgca gcggtcagct cactcgggta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page