(data stored in ACNUC1104 zone)

EMBL: CP000717.PE371

CP000717.PE371       Location/Qualifiers
FT   CDS_pept        complement(447390..447983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10371"
FT                   /old_locus_tag="TBFG_00363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0366c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04714"
FT                   /protein_id="ABR04714.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDKSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
     gtgaagcggc tcgatctggt cgccgggccc aacggcgccg gcaagtcgac gttcgtcgcc        60
     ctcacgctgg cgcccttgct gcccggcatc gtcttcgtca acgccgacga aatcgccaaa       120
     caacgctggc ccgacgaccc aacatcgcac gcctaccagg cggcgcaggt cgccgccgac       180
     acccgcgcga ggctcatcga cttgggccgg ccgttcattg ccgagacggt gttctcgcac       240
     ccatcgaagc tcgagctcat ccgcaccgcg cgcacggccg gctacaccgt cgtactgcac       300
     gtgttggtta tccccgaagg cctggcggtc gagcgcgtca ggcatcgcgt cgccgcgggc       360
     ggccacgatg tgccggagac caagatccgc gagcgtcacc gccggctggc cgagcttgtc       420
     gcccaggcca tcacgctggc cgacggcgcc accgtctatg acaaaagccg gctcgcgggc       480
     ccgcggatcg tcgctcagtt cagcgggggt ggcatcatcg ggcgcgcatg ctggccttcg       540
     tggacgccgc cacccttgat gtcacgctgg agtaacaggc ctgagacggc gtaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page