(data stored in ACNUC1104 zone)

EMBL: CP000717.PE372

CP000717.PE372       Location/Qualifiers
FT   CDS_pept        complement(448012..448401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10372"
FT                   /old_locus_tag="TBFG_00364"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0367c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04715"
FT                   /protein_id="ABR04715.1"
FT                   /translation="MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVS
FT                   NQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITT
FT                   VALNDAGDIVEHRPDGTSVVLAATP"
     gtgcccaaag ccgtcgaccg cgtcacgcgc gtcgccgcgg atctggtgga cagcgcggcg        60
     gccgagggtg ctcgtcagag ccgttcggcc aagcagcagc tcgaccactg ggcccgcgtc       120
     ggtcgggcgg tgtcgaacca gcacacggcg tcgcggcgcc gcgtggaagc tgcgctcgcg       180
     gggcatctgc cgatgacgga cctgacgctg gaggagggcg tggtgttcaa cgccgagatc       240
     tccgcagcta tcgaggagcg cctgtcgcga accaactacg gcgacgtgct cgccgcgcag       300
     ggcatcacca cggtcgccct gaacgacgcg ggcgacatcg tcgagcaccg gccagacggc       360
     acctcggtcg tgctggcggc cacgccgtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page