(data stored in ACNUC1104 zone)

EMBL: CP000717.PE379

CP000717.PE379       Location/Qualifiers
FT   CDS_pept        complement(454968..455447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10379"
FT                   /old_locus_tag="TBFG_00371"
FT                   /product="hypothetical carbon monoxyde dehydrogenase small
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0374c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04722"
FT                   /protein_id="ABR04722.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
     atgcaggtga acatgacggt aaacggcgag cccgtcaccg ccgaggtcga accccggatg        60
     ctgctggtcc attttctccg tgatcagctg cggctcaccg gaactcactg gggctgtgat       120
     accagcaact gcgggacatg cgtggtggag gtcgacggcg tgccggtgaa atcctgcacg       180
     atgctcgccg tgatggcctc cgggcacagc atccgcacgg tagagggctt ggctgggccc       240
     gacggccagc tcgacccggt gcaggaaggg ttcatgcgct gccacgggct gcaatgcggc       300
     ttctgcaccc cgggaatgct gattaccgcg cgcgccctgc tggaccgcaa cccggatccc       360
     gacgagcaga ccatccggga agcgatctcg gggcagatct gccggtgcac cggatacacc       420
     acgatcgtgc gctccattca gtgggcggca gcgcaccaga ccgtaaaggc gcagtcatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page