(data stored in ACNUC1104 zone)

EMBL: CP000717.PE380

CP000717.PE380       Location/Qualifiers
FT   CDS_pept        complement(455462..456364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10380"
FT                   /old_locus_tag="TBFG_00372"
FT                   /product="hypothetical carbon monoxyde dehydrogenase medium
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0375c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04723"
FT                   /protein_id="ABR04723.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGEGARVVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLAPELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAE
FT                   RVIADPVVRNRGTLGGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPY
FT                   ETALAHNEVLIEVRIPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLT
FT                   AVNPDPVALAELSAGLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTV
FT                   RTLRTAAGRVLGAPAAPEA"
     atgcaagtac ctgggccttt cgaatacgaa cgtgccacca gcgtggacca cgccatcgga        60
     ttgttggatc ggttggggga gggagcgcgg gtggtcgccg gcgggcacag cctgctgccg       120
     atgatgaagc tgcgcatcgc caaccccgag tacctcgtgg acatcaacga cctggccccc       180
     gaactcggct acgtcgtggt cggcggaatc aacaatccca acctggttcg gctgggtgcg       240
     atgacccgcc atcgagagat tctggactcc gatgcgctgg cggcggtgtg cccgatcttc       300
     cgcgatgccg agcgggtgat cgccgacccg gtggtccgca accgcggcac cctgggcggt       360
     tcgctctgcc aggcggatcc ggccgaggac ctgtcgaccg tgtgcaccgt tctggatgcg       420
     gtgtgcctgg cgaaagggcc ctcgggtgaa cgtgagatag cgatcgacga cttcctggtc       480
     gggccgtacg aaaccgcgct cgcccacaac gaggtcctaa ttgaggtgcg gattccgctg       540
     cggcacaaca cctccagcgc gtacgccaag gtggaacggc gggtcggcga ctgggccatc       600
     accgcggccg gtgccgcggt cacgctcgac ggccagacga tcctcgccgc tcgggtgggt       660
     ttgaccgcgg tgaatcccga cccggtcgcg ctggcggagc tgtccgcggg actggtcggc       720
     caacccgcta ccgaagaggt gttcgctgag gcgggccggc gcgccgcgca agcttgcacg       780
     ccggtgaccg acgtccgcgg caccgcggag tacaagcggc acctcgccgg tgaactgacc       840
     gttcgcacgc tgcgcaccgc cgccgggcgc gtgctcggcg cgccggcggc ccccgaggcc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page