(data stored in ACNUC1104 zone)

EMBL: CP000717.PE381

CP000717.PE381       Location/Qualifiers
FT   CDS_pept        complement(456398..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10381"
FT                   /old_locus_tag="TBFG_00373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0376c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04724"
FT                   /protein_id="ABR04724.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRTLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
     atggcgatct gggccgccgg tgacaccgcg ggggtcgcga cggtggtgcg aaccttgcgg        60
     tcagcgccgc ggcccccggg ggccgcgatg gtggtagccc cggacggttc ggtaagtggg       120
     tcggtgtcgg gcggctgcgt ggagggtgcg gtatatgagc tggccgccga ggtggcccaa       180
     accgggatac cgcggctgga acactacgga gtcagcgacg ataccgcatt cgcggtaggc       240
     ctgacctgtg gcggcatcat cgacgtcttc gtcgagcccg tatcgcgggc cacgtttccc       300
     gagctgggcg agctggccga cgacatcggc gcgcaacgcc cggtcgccat cgcgaccgtc       360
     atcgcccatc cggacgagcg gcgggtgggt cgccgactgg tgatccggcc cgacacaaag       420
     agccccgtga cgggttcgct gggttcggcg cgtgccgatg cggcggttat cgacgatgcg       480
     cggggtctgc tcgcggtggg ccgcagcgag atcctcgaat atgggcccga tgggcagcgg       540
     cgtggcgagg gcatggaggt cttcgtgtcc agccacgcgc cgcgcccgcg gacgctggtg       600
     ttcggtgcca tcgacttcgc cgccgcgctg gcgcggcagg gttcgttcct cggctaccgg       660
     gtcaccgtct gcgacgcccg cgcggtattc gccacgccag cgcgctttcc gacggccgat       720
     gacgtcgtcg tcgcatggcc ccaccgctat ctggctgccc aggcggaggc gggtggtatc       780
     gacgagcgca cggtgatctg cgtgctcacc cacgatccga agttcgacgt cccggtgctc       840
     gaggtggcgc tgcgcctggg tgtcggatac gtgggggcga tgggatcacg caagacgcac       900
     gacgaccgga tggatcggct acgcgcggcg ggcctgaccg acgccgagct gagccggttg       960
     tccagcccga tcgggctgga tctcggtgcc cgaacccccg aggagaccgc ggtctcgatc      1020
     gcggccgaca tcatcgcccg acgttggggc ggagggggac gcccgctggc cgatattgcc      1080
     ggacggatcc accatgatgc gcaggtagcg ggcgagttca aggattactt aactcgacat      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page