(data stored in ACNUC1104 zone)

EMBL: CP000717.PE382

CP000717.PE382       Location/Qualifiers
FT   CDS_pept        457589..458554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10382"
FT                   /old_locus_tag="TBFG_00374"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   lysR-family"
FT                   /note="Mapped to H37Rv Rv0377"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04725"
FT                   /protein_id="ABR04725.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIPGSGVGVTRFRPKVHVTLWS"
     atgaccccgg ctcaacttcg ggcctattcg gcggtggttc gcctgggctc ggtacgggcg        60
     gccgccgcgg aactcggtct ttccgacgcc ggagtctcca tgcacgtcgc ggcgctgcgc       120
     aaggaactcg acgacccgct gtttaccagg accggtgccg ggctggcgtt cacgcccggc       180
     gggctgcggc tggccagccg cgcggtcgaa atcctgggcc tgcaacaaca aaccgcgatc       240
     gaggtcaccg aggccgccca cgggcgtcgg ttgctgcgca tcgccgcctc cagcgccttc       300
     gccgaacacg ccgcgccggg cctgatcgag ctcttctcgt ctcgggccga cgacctttcg       360
     gtcgagttga gcgtgcatcc caccagccgg ttccgcgaac tgatctgctc gcgcgccgtc       420
     gacatcgcga tcggcccggc cagtgagagc tcgatcggtt ccgacggctc gatctttcta       480
     cggcccttcc tgaagtatca gatcatcacc gtcgtcgcgc cgaatagccc actggccgca       540
     ggcattccga tgcccgcgct gttgcgtcac cagcaatgga tgttgggtcc gtccgccggc       600
     agcgtagatg gtgagatcgc aaccatgttg cgcggcttgg cgattccgga gtcccagcaa       660
     cggatcttcc agagcgatgc cgccgcgctg gaggaggtca tgcgcgtcgg gggcgccacg       720
     ctggccattg gctttgcggt cgccaaggat cttgccgccg gacggttggt gcacgtgacc       780
     ggtcctgggc tggatcgcgc cggcgagtgg tgtgtggcga cattggcgcc ttcggcccgc       840
     caacccgccg tctccgagct tgttggcttc atcagcaccc cgaggtgtat tcaggcgatg       900
     atcccgggta gcggggtcgg ggtgacgcgg ttccgcccaa aggtccacgt caccctgtgg       960
     agctag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page