(data stored in ACNUC1104 zone)

EMBL: CP000717.PE391

CP000717.PE391       Location/Qualifiers
FT   CDS_pept        466579..469836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10391"
FT                   /old_locus_tag="TBFG_00383"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   luxR/uhpA-family"
FT                   /note="Mapped to H37Rv Rv0386"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04734"
FT                   /protein_id="ABR04734.1"
FT                   /translation="MSKLLPRGTVTLLLADVEGSTWLWETHPDDMGAAVARLDKAVSGV
FT                   IAAHDGVRPVEQGEGDSFVLAFACASDAVAAALDLQRARLAPIRLRIGVHTGEVALRDE
FT                   GNYAGPTINRTARLRDLAHGGQTVLSGVTESLVIDRLPDKAWLVDLGTHALRDLSRPER
FT                   VMQLCHPELRIDFPPLRVANDDVAHGLPVHLTRFVGRGAQITEVHRLVTDNRLVTLTGA
FT                   GGVGKTRLAAQLAAQIAGEFGRAWFVDLAPITDPDLVPVTVAGALGLHDQPGRSTTDTV
FT                   LRFLGGRPALVVLDNCEHLLDATAALVLALVKACRGVRLLATCREPLRVEGEVSYRVPS
FT                   LSLSDEAVEMFCYRAQRVRPDFRLTDDNSAAVTEICKRLDGLPLAIELAAARLRSMTLD
FT                   EIIDGLRDRFALLTGGARTAAHRQQTLWASVDWSYTLLTEPERTLFRRLAVFVGCFFVD
FT                   DAQAVACSGDVQRYQVLDEITLLVDKSLVMADDNSGRTCYRLCETMRHYALEKLSEAGE
FT                   VDAVFARHRDYYTALAARVDNPGPSDYSHCLDQAETEIDNLRAAFVWNRENSDTEGALA
FT                   LASSLLRVWMTRGRIQEGRAWFDSILADENARHLEVAAAVRARALADKALLDIFVDAAA
FT                   GMEQAQQALVIAREVDEPALLSRALTACGLIAVAVARADAAASYFAEAIDLARAVDDRW
FT                   RLAQILTFQAVDAVVAGDPVAARPAAQEARELAAAIGDHSNALWCRWCLGYAQLMRGEL
FT                   AAAAAQFGEVVDEAEASQEVLHKANSLQGLAFALAYQGELSAARAAADAALEAAELGEY
FT                   FAGMGYSALTTAALAAGDVQTAQHASEAAWRNLSLALPLSAAVQRAFNAQAALAGGDLS
FT                   AARRWCDDAVQSMTGHHLAMALATCARIAVAEGKREEAERDAHKALACAAESGAHLDLP
FT                   DVLECLAGLASDAGTHHAAARLFGAAEAIRQQIGSVRFAIYRSDYVQSVTALRDAMGEK
FT                   DFDAAWAEGAALSIKETIAYAQRGHSWRKRPATGWESLTPTEIDVVRLVGEGLANKDIA
FT                   TRLFVSPRTVQTHLTHVYTKLGFTSRLQLAQAAARRT"
     atgagcaagt tgctgccacg gggcacagtg acattgctgt tggccgacgt cgagggatcc        60
     acctggctgt gggagaccca tccagacgac atgggtgctg ccgtggcgcg cctcgacaaa       120
     gccgtgtctg gtgtgattgc cgcccatgac ggcgtacgcc cagtcgagca gggtgagggt       180
     gatagctttg tcctcgcgtt cgcctgcgcg tcggatgccg tggccgccgc gttggacttg       240
     cagcgagcgc ggctcgcacc gatccggttg cgcataggcg tgcacaccgg ggaggtcgcg       300
     ctccgcgacg aaggcaacta tgccggtccg accatcaacc ggaccgcgcg cctgcgtgac       360
     ttggcgcatg ggggccagac ggtgctctcg ggcgtgaccg aaagcctggt catcgatcgc       420
     ctcccggaca aagcatggct ggttgacctg gggacgcacg cgctgcggga tctgtcgcgt       480
     ccggagcggg taatgcagct gtgtcatccc gaattgcgta tcgatttccc gccgctgcgg       540
     gtggccaatg acgatgtggc ccatggtctt ccggtgcacc tgacgcgttt tgtggggcgc       600
     ggcgcgcaga tcaccgaggt gcaccggttg gtgaccgata accggttggt gaccctgacc       660
     ggcgccggcg gcgtgggcaa gacacggctg gcggcgcagc tcgcggcgca gatcgccggt       720
     gagttcggtc gcgcgtggtt cgtggatctg gcgccgatca cggaccccga cttggtgccg       780
     gtcacggtgg cgggcgcgct gggactgcac gaccagccgg gccgctccac gacggacacc       840
     gtgctgcgct ttcttggcgg gcgtccagcc ctggtggtgc tggataactg cgagcacctg       900
     ctggatgcga cggcggcctt ggtgttagcg ctggtgaaag cgtgccgggg ggtgaggttg       960
     ctggcaactt gtcgtgagcc gctccgggtc gagggtgagg tgagctaccg ggtgccgtcg      1020
     ctgtcactga gcgatgaagc cgttgagatg ttttgctacc gggctcagcg agtccggccg      1080
     gactttcgcc tcaccgacga caactccgcc gcagtgaccg agatctgcaa acggctggac      1140
     ggtttgccgc tggcgatcga gctggcggct gcgcggctgc ggtcgatgac gcttgacgag      1200
     atcatcgatg gcttgcgtga ccggttcgcg ctgttgaccg gcggtgcgcg cacggccgcg      1260
     caccggcagc agacgctgtg ggcctcggtg gattggtcgt acacgctatt gaccgagccg      1320
     gaacgtacct tgtttcgccg gcttgcggtg tttgtgggtt gcttttttgt cgacgacgca      1380
     caggcggttg cctgcagcgg cgatgtgcag cgctaccagg tccttgacga gatcaccctg      1440
     ctggtcgaca agtcactggt gatggccgac gacaacagcg gccggacgtg ctatcggtta      1500
     tgcgagacga tgcgccacta cgcgttggaa aaactctccg aggctggcga ggtggacgcc      1560
     gtgtttgcgc ggcaccgtga ctactacacg gcgctggctg ccagggtcga caatcccgga      1620
     ccctccgatt attcgcactg cctcgaccaa gccgaaaccg agatcgacaa cctacgtgcc      1680
     gcctttgtgt ggaaccggga aaattccgac accgagggcg ccttggcgct ggcgtcctcc      1740
     ctgttgcggg tatggatgac gcgggggcgc atccaggagg ggcgcgcctg gtttgacagc      1800
     attcttgccg acgagaatgc gcgtcatctc gaggtggcgg ccgcggtgcg cgcccgggca      1860
     ttggccgaca aggccctgct cgacatcttc gtcgacgccg ccgccggtat ggagcaggcc      1920
     caacaggctt tggtgatcgc gcgcgaggtc gatgaaccgg cgctgctgtc ccgggcgctc      1980
     acggcctgcg gcttgatcgc ggtagcggta gctcgcgccg atgcggccgc gtcttatttc      2040
     gccgaggcga tcgacctggc acgagcggta gacgaccggt ggaggctggc ccagatcctt      2100
     acctttcagg cggtcgatgc ggtcgtggcg ggtgacccgg tcgcggcacg cccggccgcc      2160
     caagaggcac gcgagctggc tgccgcgatc ggtgaccact ccaatgcgct gtggtgccgc      2220
     tggtgtctcg gctacgccca gctgatgcgg ggggagctgg ccgcggccgc cgcccaattc      2280
     ggcgaggtgg tggacgaggc cgaggcgtct caggaagtgc tgcacaaggc caacagcctg      2340
     cagggcctgg ccttcgcgct cgcctaccag ggtgaattga gtgcggctag ggcggcggcc      2400
     gacgccgctc tcgaggccgc cgagctgggc gagtacttcg cgggtatggg ctactcggcg      2460
     ttgaccacgg ccgcgttggc cgccggcgac gtgcagacgg ctcaacatgc cagcgaggcg      2520
     gcctggcgga acttgagttt ggcgctgccc ctctcggcag cggtgcagcg cgcgttcaat      2580
     gcccaggctg cactggctgg tggtgacctt agcgcagcgc gtcgttggtg tgacgatgcc      2640
     gtgcagtcaa tgaccggcca tcatctggcg atggcgctgg cgacttgcgc caggatcgcg      2700
     gtcgccgagg gcaagcggga agaagccgaa cgcgacgcgc ataaggcgct cgcgtgcgcg      2760
     gccgagagcg gggcacacct ggatctcccc gacgtgctcg aatgccttgc cggcctggcc      2820
     agcgacgccg gcacccacca tgcggcggca cgactcttcg gcgccgccga ggctatccga      2880
     cagcagatcg gctcggtccg cttcgcgatt taccgttcgg actatgtgca gtcggtgacg      2940
     gctctgcgag atgcgatggg ggagaaagac ttcgacgctg catgggccga aggtgccgcg      3000
     ttgtcgatca aggagacgat cgcctatgcg caacgtggcc actcctggcg caaacgaccg      3060
     gccaccggtt gggaatcgct tactccgacc gagattgacg tcgtgcgact ggttggcgag      3120
     ggactggcca acaaggacat cgcgacgcgg cttttcgtct caccgcgaac agtgcaaacg      3180
     cacctgacgc acgtctacac caaactcggc ttcacctcgc gactgcaact cgctcaagcg      3240
     gccgcccgcc gtacctga                                                    3258
//

If you have problems or comments...

PBIL Back to PBIL home page