(data stored in ACNUC1104 zone)

EMBL: CP000717.PE392

CP000717.PE392       Location/Qualifiers
FT   CDS_pept        complement(469840..471171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10392"
FT                   /old_locus_tag="TBFG_00384"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0386"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04735"
FT                   /protein_id="ABR04735.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGEMWAQDIVAMEGYAGASAAASQ
FT                   LPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIE
FT                   DLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDL
FT                   PEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSS
FT                   DGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAA
FT                   AAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ"
     atggatttcg gtgcgctacc accggaaatc aactccgcca gaatctattc cggtcccggc        60
     tccaggcccc tgatgcaagc ggccgcagcc tggcaacggc tggccaacga actgaccgcg       120
     acggcggctt cctactcctc ggtgatttcc gggctcaccg gcgatgactg gctgggcccg       180
     tcggcactgt cgatggcggc cgcggccgtc ccctatgtcg cgtggatgag ggccaccgcc       240
     gcctcggccg agcaggccgc ggctcaggcc gtggccgcgg cgaacgccta cgagtcggcg       300
     tacgcggcga ccgtgccccc gacggtaatc gcggccaacc gccgcacaat gctgtcactg       360
     gtcaagacca atgtttttgg ccagaacacc ccggcgatcg cgactagtga agcgcagtac       420
     ggcgaaatgt gggcccagga catcgtggcg atggagggct atgcgggcgc ctcggcggcc       480
     gcgtcgcagt tgccgccgtt caccccgcca ccggcgacca ccagcggggc cgggtcgctg       540
     agtgacgccg ccgcgacagc ggctcaggcg gtagtaccgg ccgccgcggc gaccgacgtg       600
     agcctgctac caaccctgca gtccttccta ccgccgccct tcgacgccat tccgaacccc       660
     atcgaggatc ttgacgttct cgtagccgca gctgtagccg tcgcggctgg cagtttgggg       720
     gtatcggcgg cgcagctcgg cgagatctac cgccacgacg tggtcgacga ggcccaaaag       780
     gcgccgcatt gcccagccga atccgaccag acacccgctg gggccgcggg tgacggggat       840
     ctccctgagg tcggaggacg ggtcaccagc ccgccacagc cgccggtcgc cgcgctcacc       900
     ggctactccg ctaacatcgg cggactctcc gtgccgcaca gctggaatct tccgccagcg       960
     gtgcgccaag ttgcggcgat gttccccggc gcgactccga tgtatatgac ggggagttcg      1020
     gacggctcct acgccggcct ggcagcggcg ggtttggccg gcaccggtct ggccggtctt      1080
     gccgcccgcg gtggctccgc gccgaccccg gctgcagccg ccccggccgg agccggcgga      1140
     gccggcccgg ctgccaccag gcccgccgcc cagcagacgc ccgcggtccc cgcggcggcc      1200
     gccgggtcag ccatacctgg cctaccgccc ggtttgccgc ccggcgtggt tgccaacctt      1260
     gcggcgaccc tggcggcgat ccccggagcg accatcatcg tggtaccgcc gtccccgaac      1320
     gccaatcaat ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page