(data stored in ACNUC1104 zone)

EMBL: CP000717.PE394

CP000717.PE394       Location/Qualifiers
FT   CDS_pept        472761..473183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10394"
FT                   /old_locus_tag="TBFG_00386"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0390"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04737"
FT                   /protein_id="ABR04737.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
     gtgagctacg ccggagatat cacgccactt caggcctggg agatgctcag cgataatccg        60
     cgggcggtcc tggtcgacgt gcgctgcgag gcggaatggc gcttcgtcgg tgtgcccgac       120
     ttgtcgagcc ttggtcgtga agtggtctat gtcgaatggg cgacgtccga cgggacgcac       180
     aacgacaact tcctcgccga gttgcgggac cgcatcccgg cggacgctga tcagcacgag       240
     cggcccgtta ttttcttgtg tcgctccggt aaccgctcca tcggcgcggc cgaggtcgcg       300
     accgaggcgg gcatcacgcc ggcctataac gtgctggacg gcttcgaagg gcatctcgac       360
     gctgagggtc atcgaggcgc aacgggctgg cgggcggtgg gactgccgtg gagacaggga       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page