(data stored in ACNUC1104 zone)

EMBL: CP000717.PE400

CP000717.PE400       Location/Qualifiers
FT   CDS_pept        478520..478912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10400"
FT                   /old_locus_tag="TBFG_00392"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0396"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04743"
FT                   /protein_id="ABR04743.1"
FT                   /translation="MRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYGEEVLDFEP
FT                   RTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTCAGPEPNLV
FT                   QVEFDDAAMAEAMEEMAEPDDDGEDW"
     gtgcgggcgc tcggctggct acgagaggac cgcaagccgc tgctgaatgc caaattgctc        60
     gtgctcggtc atctggcttt gaacgtctac gaccccgata acggttacgg cgaagaggtg       120
     ttggactttg agccgcggac ggtgtggtgg ggatcggcca attggaccgt gcgggccggg       180
     tcacacttgg aagttggctt tgcatgcgac gacccaaccc tcgtcgaaga agctacagcg       240
     tttgtcgctg acgtgatcgc gttctccgaa ccgatcgaca cgacctgtgc cggtcccgaa       300
     ccgaacctcg tgcaggtgga gttcgacgac gccgcgatgg ctgaggcgat ggaggagatg       360
     gccgagcccg atgatgacgg ggaggattgg tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page