(data stored in ACNUC1104 zone)

EMBL: CP000717.PE402

CP000717.PE402       Location/Qualifiers
FT   CDS_pept        479564..479812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10402"
FT                   /old_locus_tag="TBFG_00394"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0397"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04745"
FT                   /protein_id="ABR04745.1"
FT                   /translation="MHALRLVGLAILTAIAPIAVLIGSSPAHADTDIGQPCSPEGAKLW
FT                   GNPGPIYCERTADGQLQWVSIPAWALCVAFCDRPGGP"
     atgcacgcac tgaggttggt cggcttggcg atattgacgg cgatcgctcc aatcgcggtc        60
     ctcatcggaa gtagcccagc gcatgccgat accgatattg gtcaaccgtg ctcgccggaa       120
     ggcgcgaaac tctgggggaa ccccggcccg atatattgcg agcgcacggc ggacgggcaa       180
     ctgcaatggg tatcaattcc tgcttgggca ttgtgtgtgg cgttctgcga ccggcctggc       240
     gggccatag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page