(data stored in ACNUC1104 zone)

EMBL: CP000717.PE406

CP000717.PE406       Location/Qualifiers
FT   CDS_pept        482959..483330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10406"
FT                   /old_locus_tag="TBFG_00398"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0401"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04749"
FT                   /protein_id="ABR04749.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
     atgcgaccac ggcgcgcgct ggcggggctg gccgccgacg tcgtcgccgt gctggtgttc        60
     tgcgcggtgg gacgtcgcag ccacgccgaa ggactgagcg tcaccggcct ggcggctacg       120
     gcatggccat ttctcaccgg cactggtatc ggttgggtgc tggctcgcgg ctggcggcgg       180
     ccgaccgccc tcgcccccac gggggtgatc gtgtggctgt gcaccatcgt ggtcggcatg       240
     gtgttacgca aggtcagttc ggcgggtgtg gccgcgagtt tcgtcgtggt cgcgtccgcg       300
     gtcaccgcgg tgctgctgct gggttggaga gccgccgttg cgctgatggc accgcaccgc       360
     gcggacggct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page