(data stored in ACNUC1104 zone)

EMBL: CP000717.PE408

CP000717.PE408       Location/Qualifiers
FT   CDS_pept        complement(486398..486826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10408"
FT                   /old_locus_tag="TBFG_00400"
FT                   /product="membrane protein mmpS1"
FT                   /note="Mapped to H37Rv Rv0403c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04751"
FT                   /protein_id="ABR04751.1"
FT                   /translation="MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLD
FT                   PIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVV
FT                   ARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA"
     atgttcggcg ttgccaaacg cttctggatc ccgatggtga tagtcatcgt tgtggctgtc        60
     gcggccgtga cggtctcgcg gctgcactcg gtgtttggct cacatcaaca tgcgcccgac       120
     accggcaacc tcgacccgat catcgcgttt tacccgaagc atgttctcta cgaggtcttc       180
     ggcccgccag ggacggtcgc cagcatcaat tacctggatg ccgatgccca gccgcatgag       240
     gtcgtcaatg ccgcggtccc gtggtcattt accatcgtga ccaccttgac cgccgtagtc       300
     gccaacgtgg ttgcccgcgg tgacggtgca agcctgggct gtcgcatcac tgtcaacgag       360
     gtgatccgcg aggagcgcat tgtgaatgct taccacgcgc acaccagttg cctggtgaaa       420
     tccgcgtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page