(data stored in ACNUC1104 zone)

EMBL: CP000717.PE41

CP000717.PE41        Location/Qualifiers
FT   CDS_pept        complement(46682..47308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10041"
FT                   /old_locus_tag="TBFG_00041"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   marR-family"
FT                   /note="Mapped to H37Rv Rv0042c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04384"
FT                   /protein_id="ABR04384.1"
FT                   /translation="MSVVRSIGKKMQRISGPNALAVKGRPTQVYGHTHVRLDCRFMADS
FT                   EFTAPEVTQLAEGLHRALSKLISMLRRGDPNGAAAGDLTLAQLSILVTLLDQGPIRMTD
FT                   LAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDITPQGRAVHGESLANRRAA
FT                   LAALLSQLPRSDLETLRKALAPLERLASGEPASGPASNSPARKRA"
     atgagtgttg tccgctcgat tggcaagaaa atgcagcgga tttcgggacc aaatgcattg        60
     gcggtcaaag gtcgcccgac acaagtctac ggtcacacgc atgtcaggtt agactgccgg       120
     tttatggcgg acagcgaatt caccgcaccg gaagtgaccc aactggcgga ggggctgcac       180
     cgcgcattgt ccaagctgat ttcaatgctg cgccgcgggg atcccaacgg ggctgcagcc       240
     ggcgacctaa cgctggcgca actgtcgatc ctggtcaccc tgctcgatca aggtcccatc       300
     cggatgaccg acctggccgc tcacgaacgg gtgcgaactc ccaccaccac cgtggcgatc       360
     cggcggctcg agaagattgg actggtgaaa cgctcgcgag acccgtccga cttgcgggcg       420
     gtgttggtag acatcacgcc gcaagggcgg gcggttcacg gtgagtcact ggccaaccgg       480
     cgcgcggctc tggccgcgct gctcagccaa cttccccgct ccgacttgga aaccctcagg       540
     aaggccctgg cgccactgga gcgtctcgcc tcgggcgaac cggccagtgg ccctgcaagc       600
     aactcccctg ctcgcaaacg agcgtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page