(data stored in ACNUC1104 zone)

EMBL: CP000717.PE414

CP000717.PE414       Location/Qualifiers
FT   CDS_pept        497021..498178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10414"
FT                   /old_locus_tag="TBFG_00406"
FT                   /product="acetate kinase ackA (acetokinase)"
FT                   /note="Mapped to H37Rv Rv0409"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04757"
FT                   /protein_id="ABR04757.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
     atgagtagca ccgtgctggt gatcaattcc ggctcgtcgt cgctgaagtt ccagctcgtc        60
     gagccggtcg ccggcatgtc acgtgccgcc gggattgtcg agcggatcgg cgagcggtca       120
     tccccggttg ccgatcacgc ccaggcgctg catcgcgcat tcaagatgtt ggccgaggac       180
     ggaattgacc tgcagacctg cgggctggtg gcggtcggac accgggtggt ccacggcggc       240
     acggagtttc accagccgac gctgctggat gacacggtga tcggcaagct tgaggagctg       300
     tcggcgctgg ccccgttgca caacccgccg gcggtactgg gcatcaaggt ggcacgcaga       360
     ttgctggcca atgtcgcgca cgtcgcggtg ttcgatacgg cctttttcca tgacttgccc       420
     ccggcggccg cgacctatgc catcgaccgc gacgtcgccg acagatggca tatccgccgc       480
     tacggatttc atggcacttc acaccaatac gtcagcgagc gggccgccgc cttcctgggc       540
     cgcccgctcg acggtttgaa tcagattgtg ctgcatctgg gtaacggtgc ctccgcctcg       600
     gcgattgccc gcggccggcc ggtggaaacg tcgatgggcc tgacaccgct tgagggcttg       660
     gtgatgggca cccgcagtgg cgacctggac ccgggcgtca tcagctactt gtggcgcacc       720
     gcgaggatgg gtgtcgagga catcgaatcg atgctcaacc atcggtccgg gatgttgggg       780
     ttggcggggg agcgggattt tcgccgtcta cgactagtga tcgaaaccgg ggacaggtca       840
     gcacaattgg cgtatgaggt gttcatccac cggttgcgca agtaccttgg tgcctatctg       900
     gcggtgttgg gccacaccga tgtggtgagc tttaccgccg ggatcggcga aaacgatgcg       960
     gcggtgcggc gggacgcgtt ggctggcctt caggggctag gtatcgcact cgaccaagac      1020
     cgcaacctgg gcccggggca cggcgcccgg cggatttcgt cagacgattc accgatcgcc      1080
     gtgctggtgg ttcccacgaa tgaagaactg gccatcgccc gcgattgcct gagggtgctg      1140
     ggcggacgcc gagcgtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page