(data stored in ACNUC1104 zone)

EMBL: CP000717.PE417

CP000717.PE417       Location/Qualifiers
FT   CDS_pept        complement(501470..502789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10417"
FT                   /old_locus_tag="TBFG_00409"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0412c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04760"
FT                   /protein_id="ABR04760.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
     gtgacggttg agctggcgca cccgtcgacc gagccgctgg gatcacgctc gcccgccgaa        60
     ccggcacatc cccggcggtg gttcatctcg acgacacccg gccgaatcat gacgatcggc       120
     atcgtgttgg cggctctcgg cgtggccagc gccttcgcta cctccaccac catcgaacac       180
     cggcagcagg tgttgaccgc ggtgctcgac cacaccgagc cgctgtcgtt cgcggctgga       240
     cggctgtaca ccacgctgtc ggtggctgat gccgcggccg ccaccgcgtt catagcccaa       300
     gccgagccgg gcggcgttcg gctgcgctac gagcaggcca ttaccgatgc ctcggtagcg       360
     gtaacccggg cctcgagcgg gctcaccgac gaatcgttgg tgcaattgct gggccggatc       420
     aacgccgaat tggccgtcta caccggcctg gtcgagatcg cccgcgccaa caaccgggcg       480
     ggcaacccgg tcgggtcgtc atatctgtca gaggcgtcgg ggctgatgca atcgacgatc       540
     ctgcccgacg cgcaacggct ctaccaggcg acatcagcac gggtagatcg ggaaaccacc       600
     gcgtcgaccc agatcccggc cccggtgatc ctggtggtcg ccaccaccgt ggtcttcggt       660
     gcgttcgcac atcgctggct ggcccggcgc accaggcgac ggattaaccc cggtcttgtc       720
     gtgggcgcgc tcggtattct cgtcatggtg gtgtgggtgg gaactgcgct gaccatctct       780
     acaacggcca gccgtagcgc gaaagatacc gcggctgagt cactcaagac catcaccaac       840
     ctggcgatca ccgcccaaca ggcacgggcc gacgagacac tgtcgctgat ccggcgcggc       900
     gacgaagagg tccgcaagca ggccttctat cagcgcatcg acgccatgca acgccagctc       960
     aacgactaca tggcccgccg ccacgccgtc gacaaacccg atctgcaggg cgccgaccag      1020
     ctgttggtgc gctggcggca ggccaacgac cggatcaatt cctacatctc cgtcggcaac      1080
     tatcgggctg ccactcaggt ggcactgggt aaaggcgagg acgatgctac ccccgcattc      1140
     gacaagctcg acgaagcact gaccaaagcc atgggacaaa gccgcaccca actgcgccac      1200
     gacatcctca atgcgcatcg cgggctggca ggcgcgcagg tgggcggcgt ggtgctcagc      1260
     ttaggtgccg ccattgccgt cgcgctcggc ctgtggcccc ggctgaaaga gtatcggtga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page