(data stored in ACNUC1104 zone)

EMBL: CP000717.PE42

CP000717.PE42        Location/Qualifiers
FT   CDS_pept        complement(47467..48201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10042"
FT                   /old_locus_tag="TBFG_00042"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0043c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04385"
FT                   /protein_id="ABR04385.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
     atgccaaaaa agtacggggt taaggaaaag gaccaggttg tcgcccacat cctcaacctg        60
     ctattgaccg gcaaactgcg cagcggggac cgcgtcgacc gcaatgaaat cgcgcacggc       120
     ctgggggtca gccgggttcc catccaagag gcgctggttc aactcgaaca cgacggcatt       180
     gtgtcgactc gctatcaccg cggcgcgttc atcgagcggt tcgacgtcgc caccatcctg       240
     gaacatcacg aactcgacgg cttgctcaac ggcattgcct ctgcccgcgc agccgccaac       300
     cccacgcctc ggatcctggg ccagctcgac gcagtcatgc gatcgctgcg caactccaag       360
     gagtcgcggg ccttcgccga atgcgtgtgg gagtaccggc gtacggtcaa cgacgagtac       420
     gcaggaccgc ggctgcacgc caccatccgg gcctcacaga acctgattcc gcgagtgttc       480
     tggatgacat accaaaacag ccgcgacgac gtgttgccgt tctacgagga agagaacgcc       540
     gcaatccatc ggcgcgaacc tgaagctgcg agggctgcct gcatcggccg ttccgagctg       600
     atggcccaga cgatgctggc cgaactgttc cgccgccgag tattggtccc gcccgagggc       660
     gcttgtcccg gcccgtttgg ggcgccgatc cctggcttcg ccagaagcta ccagccctcc       720
     tcaccggtgc cctaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page