(data stored in ACNUC1104 zone)

EMBL: CP000717.PE422

CP000717.PE422       Location/Qualifiers
FT   CDS_pept        505536..506294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10422"
FT                   /old_locus_tag="TBFG_00414"
FT                   /product="thiamin biosynthesis protein thiG"
FT                   /note="Mapped to H37Rv Rv0417"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04765"
FT                   /protein_id="ABR04765.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGCRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
     gtggctgagt ccaagttggt tatcggtgac cgcagcttcg cctcgcggct catcatgggt        60
     actgggggtg cgaccaatct ggcggtgcta gagcaggctc tgatcgcctc aggtaccgag       120
     ctgaccaccg tcgcgatacg ccgggtcgac gccgacgggg gaaccggcct gctcgacctg       180
     ctcaaccggc tcggcatcac accgctaccc aacaccgcgg ggtgccgcag cgccgcggaa       240
     gcggtcctga cagcgcagtt ggcccgtgag gcgctgaaca ccaactgggt caagctcgag       300
     gtgattgccg acgaacgcac cctgtggcct gatgcggtcg aattagtccg ggctgcagaa       360
     caattggtgg acgacggatt tgtggtccta ccgtacacaa ccgacgaccc ggtgctggcc       420
     cgccggctag aagataccgg ttgcgcagcg gtgatgccgc tgggttcgcc gatcggcacc       480
     ggccttggta tcgccaaccc gcacaatatc gagatgatcg tcgccggtgc ccgcgttccc       540
     gtggtgctgg acgcgggcat cggtaccgcc agcgatgccg cgttggcgat ggagttgggt       600
     tgcgatgccg tgttgttggc cagtgcggtg acccgggccg ccgacccgcc ggcgatggcc       660
     gcggcgatgg ccgccgcggt gaccgccgga tatctggcgc gttgcgcggg gcggatcccg       720
     aaacgcttct gggctcaggc ttccagcccg gcacgataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page